Align alcohol dehydrogenase (EC 1.1.1.1); long-chain-alcohol dehydrogenase (EC 1.1.1.192) (characterized)
to candidate GFF658 Psest_0672 Alcohol dehydrogenase, class IV
Query= BRENDA::A4IP64 (395 letters) >FitnessBrowser__psRCH2:GFF658 Length = 382 Score = 224 bits (571), Expect = 3e-63 Identities = 136/378 (35%), Positives = 208/378 (55%), Gaps = 6/378 (1%) Query: 9 PPLSHVGWGALDQLVPEVKRLGAKHILVITDPMLVKIGLVDQVTSPLRQEGYSVHVYTDV 68 P ++ +G G+LD+ + + G + L++TD L + G+ ++V + L V+ Sbjct: 8 PAVNMMGIGSLDEAMVAIANYGFRKALIVTDVGLARAGVAEKVATLLAAADIQSVVFDGA 67 Query: 69 VPEPPLETGEKAVAFARDGKFDLVIGVGGGSALDLAKLAAVLAVHDGSVADYLNLTGTRT 128 P P + EK ++ R+ D +I +GGGS D AK A+ A + G +ADY G Sbjct: 68 QPNPTVGNVEKGLSQLRESACDFIISLGGGSPHDCAKGIALCATNGGHIADY---EGVDR 124 Query: 129 LEKKGLPKILIPTTSGTGSEVTNISVLSLET--TKDVVTHDYLLADVAIVDPQLTVSVPP 186 K LP + I TT+GT SE+T +++ E+ K + + +++ DP L V++P Sbjct: 125 SAKPQLPLVAINTTAGTASEMTRFCIITDESRHVKMAIVDRNVTPLLSVNDPALMVAMPK 184 Query: 187 RVTAATGIDALTHAVEAYVSVNASPTSDGLAVAAIRLISRSLRKAVANGSDKQARIDMAN 246 +TAATG+DALTHAVEAYVS A+P +D A+ AI LIS +LR AVA+GSD AR MA Sbjct: 185 GLTAATGMDALTHAVEAYVSTAATPITDACALKAIELISANLRTAVASGSDMPAREAMAY 244 Query: 247 GSYLAGLAFFNAGVAGVHALAYPLGGQFHIAHGESNAVLLPYVMGYIRQSCTKRMADIFN 306 +LAG+AF NA + VHA+A+ LGG + + HG NAVLLP+V Y C +R+ DI Sbjct: 245 AQFLAGMAFNNASLGYVHAMAHQLGGFYDLPHGVCNAVLLPHVESYNASVCPERLRDIAT 304 Query: 307 ALGGNSSFLSEVEASYRCVEELERFVADVGIPKTLGGFGIPESALESLTKDAVQQKRLLA 366 A+G + L + + + + D+GIP L G + +L +A+ L Sbjct: 305 AMGVETRGLDATQGAEAALAAIRTLSQDIGIPGGLAELGAKADDIPTLAANAMNDACGLT 364 Query: 367 RSPLPLLEADIRAIYEAA 384 +P + +I AI+ +A Sbjct: 365 -NPRRATQEEIEAIFHSA 381 Lambda K H 0.318 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 382 Length adjustment: 30 Effective length of query: 365 Effective length of database: 352 Effective search space: 128480 Effective search space used: 128480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory