Align aquaglyceroporin (characterized)
to candidate GFF2718 Psest_2772 MIP family channel proteins
Query= CharProtDB::CH_024677 (281 letters) >FitnessBrowser__psRCH2:GFF2718 Length = 293 Score = 396 bits (1017), Expect = e-115 Identities = 192/270 (71%), Positives = 226/270 (83%), Gaps = 6/270 (2%) Query: 6 TLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGA 65 TLKGQCIAEFLGT LLIFFG GCVAALK+ GA G WEIS+IWG+GV+MA+YL AGVSGA Sbjct: 8 TLKGQCIAEFLGTALLIFFGTGCVAALKLGGAELGLWEISIIWGIGVSMAVYLAAGVSGA 67 Query: 66 HLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGS 125 HLNPAVTIALWLF F++ +V +I++QVAGAFC+AALVYGLY +LFFDFEQ +VRGS Sbjct: 68 HLNPAVTIALWLFGTFERHRVPAYILAQVAGAFCSAALVYGLYSSLFFDFEQAQQMVRGS 127 Query: 126 VESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAPLLIGL 185 VES++LA FSTYP+ ++F QAF VEMVITAIL+ +I+A+TDDGNG+P GPLAPLLIGL Sbjct: 128 VESLELASIFSTYPHASLSFGQAFLVEMVITAILLAMIMAITDDGNGLPSGPLAPLLIGL 187 Query: 186 LIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGPIVGAI 245 LIAVIG +MGPLTGFAMNPARDFGPK+ + AGWG+VAFTGG+DIPYFLVP+F PI+GA Sbjct: 188 LIAVIGGAMGPLTGFAMNPARDFGPKLMTFFAGWGDVAFTGGKDIPYFLVPIFAPILGAC 247 Query: 246 VGAFAYRKLIGRHLP------CDICVVEEK 269 +GA Y+ LI RHLP CD +EK Sbjct: 248 LGAAGYKALICRHLPGVGSAACDAPKPKEK 277 Lambda K H 0.327 0.143 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 293 Length adjustment: 26 Effective length of query: 255 Effective length of database: 267 Effective search space: 68085 Effective search space used: 68085 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory