Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate GFF1860 Psest_1899 ABC-type sugar transport systems, ATPase components
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >FitnessBrowser__psRCH2:GFF1860 Length = 390 Score = 193 bits (490), Expect = 7e-54 Identities = 129/370 (34%), Positives = 194/370 (52%), Gaps = 15/370 (4%) Query: 3 LALDSISKKVGAQ--TWLYDMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVT 60 L L ++ K G L D++L + +G +L+G + GK++LM +AGL+ T G + Sbjct: 4 LELRNVQKSYGNSQIATLKDIALKIDAGEFLILVGPSGCGKSTLMNCIAGLENITGGEIL 63 Query: 61 VDGKDVTGMPVRDRNVAMVYQQFINYPSMKVAANIASPLKLRG--EKNIDARVREIASRL 118 VDG+D++ +DR++AMV+Q + YP+M V NIA LK+R I+ V +A L Sbjct: 64 VDGEDISQASPKDRDIAMVFQSYALYPTMSVRDNIAFGLKMRKVPAAKIEEEVARVAKLL 123 Query: 119 HIDMFLDRYPAELSGGQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFA 178 I+ L+R P++LSGGQQQRVA+ RALA+ + L DEPL NLD KLR E+R E+ + Sbjct: 124 QIEPLLERKPSQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEIKLMHQ 183 Query: 179 AGQSTVVYATTEPGEALLLGGYTAVLDEGQLLQYGPTAEVFHAPNSLRVARAFSDPPMNL 238 ++T VY T + EA+ LG AV+ +G + Q+G E+++ P +L VA PPMN Sbjct: 184 RLKTTTVYVTHDQIEAMTLGDKVAVMKDGVIQQFGTPHEIYNNPANLFVASFIGSPPMNF 243 Query: 239 MAASATAQGVRL-------QGGAELTLPL-PQGAATAAGLTVGVRASALRV-HARPGDVS 289 + + R QG EL LP+ L +G+R + + A D S Sbjct: 244 VPLRIRQRDGRWVGVLNSEQGSCELPLPITSDDGLRDRELILGIRPEQIGLAPAGSADFS 303 Query: 290 VAGVVELAEISGSDTFVHASTPWGDLVAQLTGVHYFELGTAITLHLDPAQAYVFGAD--G 347 +A +E+ E +G DT V + +L +G + L DP +A +F A Sbjct: 304 LAVDIEVVEPTGPDTLVVFTLNQVKACCRLAPDQAPRVGETLNLQFDPRRALLFDAQTGE 363 Query: 348 RLAQAPARPV 357 RL PV Sbjct: 364 RLGVVQPEPV 373 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 390 Length adjustment: 30 Effective length of query: 333 Effective length of database: 360 Effective search space: 119880 Effective search space used: 119880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory