Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate GFF857 Psest_0871 ABC-type sugar transport systems, ATPase components
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >FitnessBrowser__psRCH2:GFF857 Length = 371 Score = 196 bits (499), Expect = 6e-55 Identities = 117/323 (36%), Positives = 190/323 (58%), Gaps = 19/323 (5%) Query: 1 MARISL-DLAHSYKPNPQQDSDYALLPLKMEFEDGGAYALLGPSGCGKTTMLNIMSGLLV 59 MA ++L D+ SY P + ++ EDG +GPSGCGK+T+L +++GL Sbjct: 1 MASVTLRDICKSYDGTP------ITRHIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLED 54 Query: 60 PSHGKVLFDGRDVTRASPQERNIAQVFQFPVIYDTMTVAENLAFPLRNRKVPEGQIKQRV 119 + G +L D + V P++R++ VFQ +Y MTVAEN+AF L+ V + +IK+RV Sbjct: 55 ITSGDLLIDNQRVNDLPPKDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRV 114 Query: 120 GVIAEMLEMSGQLNQRAAGLAADAKQKISLGRGLVRADVAAVLFDEPLTVIDPHLKWQLR 179 +AE+L++ L ++ L+ +Q++++GR +VR + LFDEPL+ +D L+ Q+R Sbjct: 115 EAVAEILQLDKLLERKPKDLSGGQRQRVAIGRTMVR-EPKVFLFDEPLSNLDAFLRVQMR 173 Query: 180 RKLKQIHHELKLTLIYVTHDQVEALTFADQVVVMTRGKAVQVGSADALFERPAHTFVGHF 239 ++ ++H ++ T+IYVTHDQVEA+T AD++VV+ G+ QVG L+ P + FV F Sbjct: 174 IEIARLHQRIRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGF 233 Query: 240 IGSPGMNFLPAH---RDGENLSV---AGHRLASPV-GRAL-PAGALQVGIRPEYLALAQP 291 +GSP MNF+ E +++ +G+ L PV G A+ P L +GIRPE+ + P Sbjct: 234 LGSPQMNFVEVRAISASPETVTIELPSGYPLTLPVDGSAVSPGDPLTLGIRPEHFVM--P 291 Query: 292 QQAG-ALPGTVVQVQDIGTYQML 313 +A G + + +G Y +L Sbjct: 292 DEADFTFHGQITVAERLGQYNLL 314 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 371 Length adjustment: 29 Effective length of query: 329 Effective length of database: 342 Effective search space: 112518 Effective search space used: 112518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory