Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate GFF18 Psest_0018 ectoine/hydroxyectoine ABC transporter, permease protein EhuC
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >FitnessBrowser__psRCH2:GFF18 Length = 219 Score = 150 bits (379), Expect = 2e-41 Identities = 84/211 (39%), Positives = 129/211 (61%), Gaps = 3/211 (1%) Query: 12 VPQLLAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAAIRGTPLLVQ 71 +P LL GA VTV++T LL L+ + RL+P + + L Y+ RG+ LLVQ Sbjct: 5 LPLLLQGAWVTVKVTFFGSLLAIACALIAALARLSPVAPLRW-LAITYIEVFRGSSLLVQ 63 Query: 72 LFILFFGLPQ--FGILLPAFVCGVIGLGIYSGAYVSEVVRGAIQSIDKGQMEAARSIGMS 129 LF L+F LP F I + AF V+GLG+ GAY +EV+RGAI+S+ +GQ EA +++ M+ Sbjct: 64 LFWLYFVLPMPPFNIEMSAFAVAVVGLGLNIGAYGAEVLRGAIRSVHRGQHEACQALNMT 123 Query: 130 SGLAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEGQKIISVSYRSLEV 189 MR ++LPQA++ IPP N I L+KN++LVSL+T+ DL +++ + ++E+ Sbjct: 124 PLTRMRRIILPQALLAAIPPGTNLLIELLKNTSLVSLITLSDLAFRARQLDQATLMTMEI 183 Query: 190 YLAIAVVYFILTGATTLVLRRIELRLRAGGM 220 + V+YF+L +R++E RL G M Sbjct: 184 FGLALVIYFVLAQTINFGMRQLERRLARGRM 214 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 219 Length adjustment: 22 Effective length of query: 200 Effective length of database: 197 Effective search space: 39400 Effective search space used: 39400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory