Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate GFF16 Psest_0016 ectoine/hydroxyectoine ABC transporter, ATP-binding protein
Query= TCDB::P73721 (252 letters) >FitnessBrowser__psRCH2:GFF16 Length = 278 Score = 241 bits (615), Expect = 1e-68 Identities = 132/255 (51%), Positives = 177/255 (69%), Gaps = 9/255 (3%) Query: 7 PLISFDQLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRLE 66 PL+ F + K +G L VL G+ +I + ++IIGPSG GKST LR L LE I G +E Sbjct: 23 PLVRFAGVTKRYGELTVLDGLDLQIEEGEKVAIIGPSGSGKSTLLRVLMTLEGIDEGVIE 82 Query: 67 VAGV------DLSGAKI--DQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRI 118 V G D SG + + +HLR++R +VGMVFQ FNLFPH+ LQN++ AP +VL + Sbjct: 83 VDGEPLTHMPDASGQLVPANARHLRRVRGKVGMVFQSFNLFPHMNALQNVMEAPVQVLGL 142 Query: 119 PMAEAKDRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALD 178 AEA+ RA L VGL K +++P QLSGGQ+QRVAIAR L M+P+++LFDE TSALD Sbjct: 143 SKAEARGRAEELLAMVGLEDKLEHFPAQLSGGQQQRVAIARALAMRPKVMLFDEVTSALD 202 Query: 179 PELVGEVLNVMKQLAE-EGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNP 237 PEL GEVLNV+++L E +TM +VTH+M FARE ++RV FF+QG I E+G P+E+F NP Sbjct: 203 PELCGEVLNVIRRLGEAHNLTMLMVTHQMGFAREFADRVCFFHQGRIHEQGSPDELFNNP 262 Query: 238 KSDRLRAFLSRIQSS 252 + +R R FLS + + Sbjct: 263 QEERTREFLSAVNEA 277 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 278 Length adjustment: 25 Effective length of query: 227 Effective length of database: 253 Effective search space: 57431 Effective search space used: 57431 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory