Align Histidine transport system permease protein HisM (characterized)
to candidate GFF17 Psest_0017 ectoine/hydroxyectoine ABC transporter, permease protein EhuD
Query= SwissProt::P0AEU3 (238 letters) >FitnessBrowser__psRCH2:GFF17 Length = 219 Score = 94.0 bits (232), Expect = 2e-24 Identities = 61/202 (30%), Positives = 99/202 (49%), Gaps = 10/202 (4%) Query: 26 TLWLLILSVVIGGVLALFLAIGRVSSNKYIQFPIWLFTYIFRGTPLYVQLLVFYSGMYTL 85 T+ + + I VL LFLAIGR S +++ +PI R TPL +Q+ Y L Sbjct: 23 TIGIALAGFAIAVVLGLFLAIGRRSRLRWLSWPITGLIEFIRSTPLLIQV-------YFL 75 Query: 86 EIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFK 145 V LN S + ++ + L+ YT E++ + +VP + EA A + Sbjct: 76 FYVFPNYGLNL---SAMQAGIIGIALHYACYTAEVYRAGLDAVPRSQWEAVTALNMKPWT 132 Query: 146 MYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINAATYQPFTAFGI 205 YR +ILP ALR LPA N +I +L T + TV ++++ A++I + +++ + Sbjct: 133 AYRDVILPQALRPVLPALGNYLISILKDTPVLSAITVVEIMQRAKNIGSESFRYLEPITM 192 Query: 206 AAVLYLIISYVLISLFRRAEKR 227 + +LI+S L RR E R Sbjct: 193 VGIFFLILSLGLAWCVRRLENR 214 Lambda K H 0.330 0.142 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 219 Length adjustment: 23 Effective length of query: 215 Effective length of database: 196 Effective search space: 42140 Effective search space used: 42140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory