Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate GFF1056 Psest_1089 ABC-type branched-chain amino acid transport systems, ATPase component
Query= TCDB::Q55164 (267 letters) >FitnessBrowser__psRCH2:GFF1056 Length = 258 Score = 178 bits (451), Expect = 1e-49 Identities = 99/248 (39%), Positives = 151/248 (60%), Gaps = 6/248 (2%) Query: 18 LLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLF 77 +L +GL+K F G AVD D+ V++G I LIGPNGAGKTT+FNLL+ F+ P +GE+L+ Sbjct: 6 VLETRGLTKEFRGFTAVDSVDLKVRQGHIHALIGPNGAGKTTVFNLLTKFLTPTRGEILY 65 Query: 78 NGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQ 137 G +I + ++IA G VR+FQ++ V ++VLEN+ +A Q + G F +F R + Sbjct: 66 RGKNITSMKANEIARLGLVRSFQISAVFGHMSVLENVRVALQQKMGNSF-----HFWRSE 120 Query: 138 KEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGV 197 + R ++ M +L V L + AQ A L G+++ LE+A L +P ++LLDEP G+ Sbjct: 121 RSLRELDDQVMQLLAEVDLQSFAQTLAVELPYGRKRALELATTLALDPFVLLLDEPTQGM 180 Query: 198 NPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQIQSDP 257 + + E +V T L++EHN+ V+ LC + VLA G LA+G E + ++P Sbjct: 181 GSEDVDMVVE-LVRKAAANRTVLMVEHNLSVVSRLCDRITVLARGSVLAEGDYESVSANP 239 Query: 258 RVLEAYLG 265 +V EAYLG Sbjct: 240 QVREAYLG 247 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 258 Length adjustment: 25 Effective length of query: 242 Effective length of database: 233 Effective search space: 56386 Effective search space used: 56386 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory