GapMind for catabolism of small carbon sources


Aligments for a candidate for acn in Pseudomonas stutzeri RCH2

Align Aconitate hydratase A; Aconitase; (2R,3S)-2-methylisocitrate dehydratase; (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate dehydratase; Iron-responsive protein-like; IRP-like; Probable 2-methyl-cis-aconitate hydratase; RNA-binding protein; EC; EC (characterized)
to candidate GFF2274 Psest_2319 aconitate hydratase 1/2-methylisocitrate dehydratase, Fe/S-dependent

Query= SwissProt::Q937N8
         (869 letters)

>lcl|FitnessBrowser__psRCH2:GFF2274 Psest_2319 aconitate hydratase
           1/2-methylisocitrate dehydratase, Fe/S-dependent
          Length = 867

 Score = 1433 bits (3710), Expect = 0.0
 Identities = 712/866 (82%), Positives = 781/866 (90%), Gaps = 6/866 (0%)















           CRLD+  EVS+Y+AGGVL  FA+DFL

Lambda     K      H
   0.318    0.135    0.398 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 2244
Number of extensions: 74
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 869
Length of database: 867
Length adjustment: 42
Effective length of query: 827
Effective length of database: 825
Effective search space:   682275
Effective search space used:   682275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

Align candidate GFF2274 Psest_2319 (aconitate hydratase 1/2-methylisocitrate dehydratase, Fe/S-dependent)
to HMM TIGR02333 (acnD: 2-methylisocitrate dehydratase, Fe/S-dependent (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02333.hmm
# target sequence database:        /tmp/gapView.5800.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02333  [M=858]
Accession:   TIGR02333
Description: 2met_isocit_dHY: 2-methylisocitrate dehydratase, Fe/S-dependent
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
          0 1775.3   0.0          0 1775.1   0.0    1.0  1  lcl|FitnessBrowser__psRCH2:GFF2274  Psest_2319 aconitate hydratase 1

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__psRCH2:GFF2274  Psest_2319 aconitate hydratase 1/2-methylisocitrate dehydratase, Fe/S-dependent
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1775.1   0.0         0         0       1     857 [.       2     864 ..       2     865 .. 0.99

  Alignments for each domain:
  == domain 1  score: 1775.1 bits;  conditional E-value: 0
                           TIGR02333   1 ntkyrkalpgtdldyfdaraaveaikpgaydklpytsrvlaenlvrrvdpetleaslkqlierkreldfpwypar 75 
                                         nt++rk+lpgt ldyfd+r+a+eai+pg+ydklpytsrvlae+lvrr++pe l++slkq+ierkr+ldfpwypar
                                         7999*********************************************************************** PP

                           TIGR02333  76 vvchdilgqtalvdlaglrdaiaekggdpaqvnpvvetqlivdhslaveyggfdpdafeknraiedrrnedrfhf 150
                                         *************************************************************************** PP

                           TIGR02333 151 inwtkkafknvdvipagngimhqinlekmspvvqvkegvafpdtlvgtdshtphvdalgviaigvggleaetvml 225
                                         i+wtk+afknvdvipagngimhqinlekmspv+q++ gvafpdt+vgtdshtphvdalgviaigvggleaetvml
                                         *************************************************************************** PP

                           TIGR02333 226 graslmrlpdivgveltgkrqpgitatdivlalteflrkekvvsayleffgegakaltlgdratisnmtpeygat 300
                                         g +s+mrlpdivgv+ltgkrqpgitatdivlalteflrke+vv+a++effgega +lt+gdratisnm+peygat
                                         *************************************************************************** PP

                           TIGR02333 301 aamfaideqtidylkltgreeeqvklvetyakaaglwadslkkavyervlkfdlssvvrnlagpsnpharlatsd 375
                                         a+mf+id+qtidylkltgre+eqv+lve yak +glwa +l+ a+yervl+fdlssvvrn+agpsnph+rl+ts 
                                         *************************************************************************** PP

                           TIGR02333 376 laakgiakevee......eaeglmpdgaviiaaitsctntsnprnvvaagllarnanklglkrkpwvksslapgs 444
                                         l  +gia e +       eaegl+pdgaviiaaitsctntsnprnvvaaglla++an+lgl rkpwvk+s+apgs
                                         ******98754333444499******************************************************* PP

                           TIGR02333 445 kvvklyleeagllkeleklgfgivafacttcngmsgaldpviqqeiidrdlyatavlsgnrnfdgrihpyakqaf 519
                                         *************************************************************************** PP

                           TIGR02333 520 laspplvvayaiagtirfdiekdvlgvdadgkeirlkdiwpsdeeidavvaaavkpeqfrkvyipmfdledaqkk 594
                                         laspplvvayaiagt+rfdie+dvlg+d++g++i lkd+wpsdeeida+va++vkpeqf+++yipmfdl++ +++
                                         *************************************************************************** PP

                           TIGR02333 595 vsplydwrpmstyirrppywegalagertlkgmrplavlgdnittdhlspsnailldsaageylakmglpeedfn 669
                                         *************************************************************************** PP

                           TIGR02333 670 syathrgdhltaqratfanpklfnemvkedgkvkqgslariepegkvtrmweaietymnrkqpliiiagadygqg 744
                                         syathrgdhltaqratfanp+l+nem+ +dgk ++gslar+epegkv+rmweaietymnrkq lii+agadygqg
                                         *************************************************************************** PP

                           TIGR02333 745 ssrdwaakgvrlagveaivaegferihrtnlvgmgvlplefkpgtnrktlaldgtevydvvgeitpradltlvvt 819
                                         ssrdwaakgvrlagve ivaegferihrtnlvgmgvlp+efkpgt r tl+ldgte++d+ ge +pr+dltlv++
                                         *************************************************************************** PP

                           TIGR02333 820 rkngeklevpvtcrldtaeevsvyeaggvlqrfaqdfl 857
                                            ge+  vpvtcrldta evsvy+aggvlqrfa+dfl
                                         *************************************8 PP

Internal pipeline statistics summary:
Query model(s):                            1  (858 nodes)
Target sequences:                          1  (867 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.02s 00:00:00.07 Elapsed: 00:00:00.06
# Mc/sec: 12.27

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory