GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ech in Pseudomonas stutzeri RCH2

Align Peroxisomal bifunctional enzyme; PBE; PBFE; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 (characterized)
to candidate GFF4162 Psest_4235 3-hydroxyacyl-CoA dehydrogenase

Query= SwissProt::Q08426
         (723 letters)



>lcl|FitnessBrowser__psRCH2:GFF4162 Psest_4235 3-hydroxyacyl-CoA
           dehydrogenase
          Length = 701

 Score =  499 bits (1286), Expect = e-145
 Identities = 298/727 (40%), Positives = 430/727 (59%), Gaps = 41/727 (5%)

Query: 1   MAEYTRLH--NALALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFS 58
           M +  RL     +ALI + NPPVNA+   +   +++  Q A  D  ++A+ +      F 
Sbjct: 1   MTDVVRLEVQGEIALITVNNPPVNALGQAVREGLQKAFQSAEADPQVRAVALVCEGNTFI 60

Query: 59  AGADIRGFSAPRTFGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEA 118
           AGADI+ F  P     +L  V++ I+   K  VA I G A GGGLE+ALGCHYRIA  +A
Sbjct: 61  AGADIKEFGKPPQ-APSLPEVIEIIEACNKSSVAVIHGTALGGGLEVALGCHYRIARKDA 119

Query: 119 QVGLPEVTLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPV 178
           +VGLPEV LGLLPGA GTQ LPRL GV  AL++I SG+ I A EA++  I+D++   D V
Sbjct: 120 KVGLPEVKLGLLPGAGGTQRLPRLAGVEKALEMIVSGQPISAAEAVEHNIVDELFEGDLV 179

Query: 179 EEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMR-----RQHPGCLAQEAC 233
           E  + + +R+ ++    RR   +  Q L   D+   EAL++ +     ++ PG  +   C
Sbjct: 180 EAGLAYVRRMVEEGRTPRRT-GEQTQGLEGADN---EALIRAKHAEVAKRMPGLFSPLRC 235

Query: 234 VRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANKWST-PSGASWKTA 292
           + AV+AA + P   G+K+E ELF   L S Q  AL ++FFAER+A K +  PS       
Sbjct: 236 IAAVEAATKLPLAEGLKRERELFAECLNSPQRGALVHSFFAERQAGKINDLPSDTK---- 291

Query: 293 SARPVSSVGVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASKMQ 352
             R ++S  V+G GTMG GI +SFA A +PV  ++ ++  L    + +    +  A+ ++
Sbjct: 292 -PRSINSAAVIGGGTMGVGIALSFANAGVPVKLLEINEEAL---QRGLQRARDTYAASVK 347

Query: 353 QSGHPWSGPKPRLT-----SSVKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLC 407
           +        + RL      +    L   D+V+EAVFEEM +K+QVF +L A+CKP A L 
Sbjct: 348 RGSLTEDAMEQRLALIEGVTEYAALADADVVVEAVFEEMGVKQQVFEQLDAICKPGAILA 407

Query: 408 TNTSALDVDEIASSTDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIK 467
           +NTS+LD+D IA+ T RP  V+G HFFSPA+VM+LLEV+    +S   +AT M + K++K
Sbjct: 408 SNTSSLDLDAIAAFTKRPEDVVGLHFFSPANVMRLLEVVRGAKTSDEVLATAMAIGKQLK 467

Query: 468 KIGVVVGNCFGFVGNRMLNPYYNQAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGL 527
           K+ VVVG C GFVGNRM+  Y  +A FLLEEG+ P++VD  L  FG  MGPF + DL+GL
Sbjct: 468 KVSVVVGVCDGFVGNRMVFQYGREAEFLLEEGATPQQVDAALRNFGMAMGPFAMRDLSGL 527

Query: 528 DVGWKSRKGQGLTGPTLLPGTPARKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLG 587
           D+G   RK Q  T P  L            +  + D LC  G  GQKTG G+Y+Y+ P  
Sbjct: 528 DIGQAIRKRQRATLPAHLD-----------FPTVSDKLCAAGMLGQKTGAGYYRYE-PGN 575

Query: 588 RIHKPDPWLSKFLSRYRKTHHIEPRTISQDEILERCLYSLINEAFRILGEGIAASPEHID 647
           R  + +P L+  L        IE + + +  I+ERC+++L+NE  +IL EGIA     ID
Sbjct: 576 RTPQENPDLAPMLEAASLEKGIERKALDEQYIVERCIFALVNEGAKILEEGIAQRSSDID 635

Query: 648 VVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNP 707
           V+YL+GYG+P  +GGPMFYA +VGL  VL ++++ + +  D    +P+  L+KLA++G  
Sbjct: 636 VIYLNGYGFPAFRGGPMFYADSVGLDRVLARVKELHARCGD--WWKPAPLLEKLAAEGR- 692

Query: 708 PLKEWQS 714
              +WQ+
Sbjct: 693 TFTDWQA 699


Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1152
Number of extensions: 56
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 723
Length of database: 701
Length adjustment: 39
Effective length of query: 684
Effective length of database: 662
Effective search space:   452808
Effective search space used:   452808
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory