Align NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate GFF3786 Psest_3855 Branched-chain amino acid ABC-type transport system, permease components
Query= TCDB::Q8YXD0 (288 letters) >FitnessBrowser__psRCH2:GFF3786 Length = 295 Score = 123 bits (308), Expect = 6e-33 Identities = 82/282 (29%), Positives = 157/282 (55%), Gaps = 11/282 (3%) Query: 7 QLIVNGIAVGSIIALAAVGLTLTYGILRLSNFAHGDFLTLGAYLTFFV-NTFGVNIWLSM 65 QL++ G+ GS A+ ++GL + +G+L++ NFAHG +GA+ + + T G+ W ++ Sbjct: 15 QLLI-GLINGSFYAMLSLGLAIIFGMLKIINFAHGAQYMIGAFAGYLLLATLGIGYWPAL 73 Query: 66 IVA--VVGTVGVMLLSEKLLWSRMRSIRANSTTLIIISIGLALFLRNGIILIWGGRNQNY 123 I+A +VG ++ E+L SR+ ++ + ++ + GLAL L +G Q Y Sbjct: 74 ILAPIIVGLCSAVI--ERLALSRLYNL--DHLYSLLFTFGLALALEGAFRYFYGSSGQPY 129 Query: 124 NLP--ITPALDIFGVKVPQNQLLVLALAVLSIGALHYLLQNTKIGKAMRAVADDLDLAKV 181 +P + ++ + +P+ + V+ +++ A L++ TK+G +RA ++ L + Sbjct: 130 AVPKELAGGYNLGFMFLPKYRAWVVLASLVICIASWLLIEKTKLGAYLRAATENPTLVRT 189 Query: 182 SGIDVEQVIFWTWLIAGTVTSLGGSMYGLITAVRPNMGWFLILPLFASVILGGIGNPYGA 241 GI+V ++ +T+ + + L G + I V P MG LI+ +FA V++GG+G+ GA Sbjct: 190 FGINVPLLLTFTYGMGAALAGLAGMLAAPIYQVSPLMGSNLIIVVFAVVVVGGMGSILGA 249 Query: 242 IAAAFIIGIVQEVSTPFLGSQYKQGVALLIMILVLLIRPKGL 283 I +++GI++ ++ F + V +IM +VLL+RP GL Sbjct: 250 IITGYMLGILEGLTKVFY-PEASNIVIFVIMAIVLLVRPAGL 290 Lambda K H 0.328 0.144 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 295 Length adjustment: 26 Effective length of query: 262 Effective length of database: 269 Effective search space: 70478 Effective search space used: 70478 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory