Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate GFF69 Psest_0069 UDP-glucose-4-epimerase
Query= curated2:P55180 (339 letters) >FitnessBrowser__psRCH2:GFF69 Length = 354 Score = 418 bits (1075), Expect = e-122 Identities = 202/334 (60%), Positives = 257/334 (76%), Gaps = 1/334 (0%) Query: 3 ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLLDR 62 ILVTGGAGYIGSH +ELL +G+E++VLDNL NSS AL+RV+++ G+ L F + D+ +R Sbjct: 2 ILVTGGAGYIGSHAVLELLQAGHEVLVLDNLCNSSQLALDRVEQLAGRPLHFVKGDVRNR 61 Query: 63 EAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVFS 122 + ++FA + AV+HFAGLKAVGESV PL+YY N+ G+ LC+AM + GV K+VFS Sbjct: 62 ALLKALFAAYPVTAVMHFAGLKAVGESVREPLRYYETNVGGSIALCQAMAEAGVFKLVFS 121 Query: 123 SSATVYGVPETSPITEDFPLGA-TNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPFG 181 SSATVYG PITED P G TNPYGQ+KLM E +L+ L +D WS+ LLRYFNP G Sbjct: 122 SSATVYGESPVMPITEDRPTGVPTNPYGQSKLMAENVLKGLADSDPRWSIGLLRYFNPIG 181 Query: 182 AHPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAEG 241 AH SG IGEDPNG+PNNL+PY+ QVAVG+ +QL+V+GNDYPT DGTGVRDYIHVVDLA+G Sbjct: 182 AHESGLIGEDPNGVPNNLLPYMLQVAVGRRKQLNVYGNDYPTLDGTGVRDYIHVVDLAKG 241 Query: 242 HVKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFAD 301 H+KALE++ G +NLGTG G+SV EM+ AFE+V+G+ +P+ RR GDIA C++D Sbjct: 242 HLKALERLQLIHGVSTWNLGTGKGHSVREMITAFEEVTGRSLPHVIKPRRSGDIAQCWSD 301 Query: 302 PAKAKRELGWEAKRGLEEMCADSWRWQSSNVNGY 335 P+KA+RELGW A++ L M AD+WRWQS N GY Sbjct: 302 PSKAERELGWRAEKDLTSMLADAWRWQSRNPRGY 335 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 354 Length adjustment: 29 Effective length of query: 310 Effective length of database: 325 Effective search space: 100750 Effective search space used: 100750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate GFF69 Psest_0069 (UDP-glucose-4-epimerase)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.21162.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-141 454.4 0.0 1e-140 454.3 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF69 Psest_0069 UDP-glucose-4-epimera Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF69 Psest_0069 UDP-glucose-4-epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 454.3 0.0 1e-140 1e-140 1 331 [. 1 334 [. 1 335 [. 0.99 Alignments for each domain: == domain 1 score: 454.3 bits; conditional E-value: 1e-140 TIGR01179 1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavleeekidavi 75 +iLvtGgaGyiGsh v +ll++g+ev+vlDnl+++s+ al ++e++ +++v+gd+++++ l+a++++ + av+ lcl|FitnessBrowser__psRCH2:GFF69 1 MILVTGGAGYIGSHAVLELLQAGHEVLVLDNLCNSSQLALDRVEQLAgrPLHFVKGDVRNRALLKALFAAYPVTAVM 77 59*******************************************99989*************************** PP TIGR01179 76 HfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEespln.pinpYGrsklm 151 Hfa+l+avgEsv+ePl+YYe nv +++ L++am++agv+kl+Fsssa+vYges +pi+E+ p++ p+npYG+sklm lcl|FitnessBrowser__psRCH2:GFF69 78 HFAGLKAVGESVREPLRYYETNVGGSIALCQAMAEAGVFKLVFSSSATVYGESPVMPITEDRPTGvPTNPYGQSKLM 154 *****************************************************************9*********** PP TIGR01179 152 vErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaevavgkrekleifGtdyptkDGtcvRD 227 +E++lk l+++d+++++ +LRYFn++GA+e+g iGe++++ + +l++++++vavg+r++l+++G+dypt DGt+vRD lcl|FitnessBrowser__psRCH2:GFF69 155 AENVLKGLADSDPRWSIGLLRYFNPIGAHESGLIGEDPNGVPnNLLPYMLQVAVGRRKQLNVYGNDYPTLDGTGVRD 231 ******************************************9********************************** PP TIGR01179 228 yiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsgkdikveladrRaGDpaslvadaskikre 304 yiHv Dla++Hl+ale l+ ++++++nlG+g+g+sv+e+i a+++v+g++++ +++rR+GD+a++++d+sk++re lcl|FitnessBrowser__psRCH2:GFF69 232 YIHVVDLAKGHLKALERLQLIHGVSTWNLGTGKGHSVREMITAFEEVTGRSLPHVIKPRRSGDIAQCWSDPSKAERE 308 ***************************************************************************** PP TIGR01179 305 lgwkpkyddLeeiiksawdWekklkeg 331 lgw+++ d L ++++aw+W++++++g lcl|FitnessBrowser__psRCH2:GFF69 309 LGWRAEKD-LTSMLADAWRWQSRNPRG 334 ******99.**************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (354 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.27 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory