Align Dihydrolipoyllysine-residue acyltransferase component of branched-chain alpha-ketoacid dehydrogenase complex; Branched-chain alpha-ketoacid dehydrogenase complex component E2; BCKADH E2; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase; EC 2.3.1.168 (characterized)
to candidate GFF1388 Psest_1425 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes
Query= SwissProt::O06159 (393 letters) >FitnessBrowser__psRCH2:GFF1388 Length = 233 Score = 92.0 bits (227), Expect = 1e-23 Identities = 72/222 (32%), Positives = 104/222 (46%), Gaps = 6/222 (2%) Query: 165 PDVRPVHGVHARMAEKMTLSHKEIPTAKASVEVICAELLRLRDRFVSAAPEITPFALTLR 224 P+ P+ G+ +A KM S + E L R + ++ L L Sbjct: 12 PERVPLKGMRKMIAAKMHESLQTTAQLTHHAECRLDALKTRRAELKAEGSAVSVQDLLLL 71 Query: 225 LLVIALKHNVILNSTWVDSGEGPQVHVHRGVHLGFGAATERGLLV-PVVTDAQDKNTREL 283 ++ LK + LN+T D +H H VHLG LLV P + DA+ + L Sbjct: 72 KVIETLKAHPGLNATLEDE----VIHQHVAVHLGLAIPLPGDLLVAPALFDAEQLDGESL 127 Query: 284 ASRVAELITGAREGTLTPAELRGSTFTVSNFGALGVDDGVPVINHPEAAILGLGAIKPR- 342 L+ A G L+ EL G+TFTVSN G V P++N P+ AILG+G I+ R Sbjct: 128 CQARKALVDKALAGKLSVKELTGATFTVSNLGLSRVHHFTPILNPPQVAILGVGGIQRRL 187 Query: 343 PVVVGGEVVARPTMTLTCVFDHRVVDGAQVAQFMCELRDLIE 384 + GE+V M L+ FDHR V+G+ A+F+ +L IE Sbjct: 188 ELGPSGELVEVEWMGLSLTFDHRAVNGSPAAEFLDDLCRRIE 229 Lambda K H 0.317 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 233 Length adjustment: 27 Effective length of query: 366 Effective length of database: 206 Effective search space: 75396 Effective search space used: 75396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory