Align Broad specificity amino-acid racemase; Broad spectrum racemase; EC 5.1.1.10 (characterized)
to candidate GFF685 Psest_0699 alanine racemase
Query= SwissProt::Q88GJ9 (409 letters) >FitnessBrowser__psRCH2:GFF685 Length = 358 Score = 116 bits (290), Expect = 1e-30 Identities = 106/335 (31%), Positives = 165/335 (49%), Gaps = 23/335 (6%) Query: 48 VSASALQHNIRTLQAELAGKSKLCAVLKADAYGHGIGLVMPSI--IAQGVPCVAVASNEE 105 V +AL+HN L + A + K AV+KA+AYGHG + ++ IA G AVA EE Sbjct: 8 VDLTALRHNY-LLAKQCAPQRKAFAVVKANAYGHGACEAVTALREIADGF---AVACLEE 63 Query: 106 ARVVRASGFTGQLVRVRLASLSELEDGLQYDMEELVGSAEFARQAD-AIAARHGKTLRIH 164 A +R S +++ L E + L+ L + + RQAD +AA + L + Sbjct: 64 AEDIRRSAPDARILL--LEGCFEPAEYLRAAELGLDVAVQDQRQADWLLAANISRPLNVW 121 Query: 165 MALNSSGMSRNGVEMATWSGRGEALQITDQKHLKLVALMTHFAVEDKDDVRKGLAAFNEQ 224 + L+S GM R G + E L+ + + + L++HFA D+ +G Q Sbjct: 122 LKLDS-GMHRLGFTLEGLRDCHERLK--GKAQVGELNLISHFACADE----RGHPLTELQ 174 Query: 225 TDWLIKHARLDRSKLTLHAANSFATLEVPEARLDMVRTGGALFGDTVPARTEYKR----- 279 + + L+ +L ANS A L +P+A + +R G L+G T A + Sbjct: 175 LERYAELLSLEFDNCSL--ANSAAVLTLPQAHMAWIRPGIMLYGATPFAELSAQELGLRP 232 Query: 280 AMQFKSHVAAVHSYPAGNTVGYDRTFTLARDSRLANITVGYSDGYRRVFTNKGHVLINGH 339 M + AV G +VGY ++ R SR+ ++ GY+DGY R + V+I+G Sbjct: 233 VMTLTGALIAVRDVSEGESVGYGASWVAQRASRIGTVSCGYADGYPRTAPSGTSVVIHGQ 292 Query: 340 RVPVVGKVSMNTLMVDVTDFPDVKGGNEVVLFGKQ 374 RVP+ G+VSM+ L VD+TD P + G+ V L+G Q Sbjct: 293 RVPLAGRVSMDMLAVDLTDLPQAQLGDAVELWGAQ 327 Lambda K H 0.318 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 409 Length of database: 358 Length adjustment: 30 Effective length of query: 379 Effective length of database: 328 Effective search space: 124312 Effective search space used: 124312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory