Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate GFF3258 Psest_3321 Predicted amidohydrolase
Query= reanno::pseudo3_N2E3:AO353_07425 (264 letters) >FitnessBrowser__psRCH2:GFF3258 Length = 281 Score = 82.0 bits (201), Expect = 1e-20 Identities = 74/239 (30%), Positives = 103/239 (43%), Gaps = 16/239 (6%) Query: 14 DVAGNLQRLQKLATEAK--GADLLVFPEMFLTGYNIGAEAVGALAEAQDGTCAQYIASIA 71 DVA NL ++L A GA L V PE F + + A+G +G ++ A Sbjct: 13 DVALNLTCARQLLERAAQAGARLAVLPENFAAMGHKASAALGRAEAMGEGPILPWLKQAA 72 Query: 72 KASGIAIVYGY----PERAEDGQIYNAVQLIDSRGQRLANYRKTHLF--------GELDH 119 + + IV G + G+ L D +GQR+A Y K HLF G+ Sbjct: 73 RDLRLWIVAGTLPLPADECPQGKPNACSLLFDDQGQRVARYDKLHLFDAAVADSRGQYRE 132 Query: 120 SMFSVGPDEFPLVELNGWKLGFLICYDLEFPENARRLALAGAELILVPTA-NMIPYDFIA 178 S + +V+ +LG +CYDL F E L AGAELI VP+A + + Sbjct: 133 SDDYAAGERLVVVDTPVGRLGMSVCYDLRFAELYTALRAAGAELISVPSAFTTVTGEAHW 192 Query: 179 DVTVRSRAFENQCYVAYANYCG-HEGEIHYCGQSSIAAPDGSRIAQAGLDEALIVGTLD 236 +R+RA E QCY+ A G H G G SSI P G + + A +V D Sbjct: 193 TSLIRARAIETQCYILAAAQGGEHPGGRFTHGHSSIVDPWGRLLCEQATAPAALVAERD 251 Lambda K H 0.322 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 281 Length adjustment: 25 Effective length of query: 239 Effective length of database: 256 Effective search space: 61184 Effective search space used: 61184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory