GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gcdH in Pseudomonas stutzeri RCH2

Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate GFF1051 Psest_1084 Acyl-CoA dehydrogenases

Query= metacyc::G1G01-166-MONOMER
         (393 letters)



>lcl|FitnessBrowser__psRCH2:GFF1051 Psest_1084 Acyl-CoA
           dehydrogenases
          Length = 387

 Score =  211 bits (538), Expect = 2e-59
 Identities = 131/376 (34%), Positives = 200/376 (53%), Gaps = 7/376 (1%)

Query: 15  LDQQLTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPA-IFREMGEVGLLGATIPEQY 73
           L+  L E   M+R+    F   ++APR  EA   E   PA ++R+ GE+GLLG T+ E+Y
Sbjct: 6   LNFALGETIDMLREQVQAFVAAEIAPRA-EAIDQENLFPADMWRKFGEMGLLGVTVSEEY 64

Query: 74  GGSGLNYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASGEW 133
           GG+GL Y+ + +   E+ R  +         S+L +  IN  G   QK +YLPKL SGE 
Sbjct: 65  GGAGLGYLAHVVAMEEISRGSASVALSYGAHSNLCVNQINRNGNPEQKARYLPKLISGEH 124

Query: 134 IGCFGLTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAKDD----AG 189
           +G   ++EPN GSD  SM  RA K    Y L GSK WITN P A+ +V++AK D    A 
Sbjct: 125 VGALAMSEPNAGSDVVSMKLRAEKRGDRYVLNGSKTWITNGPDANTYVIYAKTDLDKGAH 184

Query: 190 DIRGFVLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIF-PDVRGLKGPFTCL 248
            I  F++E+ W+G S      K+G+R S T E+  D+V VP+EN+   +  G+K   + L
Sbjct: 185 GITAFIVERDWKGFSRGNKFDKLGMRGSNTCELFFDDVEVPQENVLGAENGGVKVLMSGL 244

Query: 249 NSARYGISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLALQGC 308
           +  R  ++ G  G  ++C      Y  DR+QFG+ +   Q IQ K+ADM T++  +    
Sbjct: 245 DYERVVLAGGPTGIMQSCLDVVVPYIHDRKQFGQSIGEFQFIQGKVADMYTQLNASRAYL 304

Query: 309 LRLGRMKDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHLVNLEVV 368
             + +  D G    +  + +   +   A  +A  A  +LGGNG  +EF   R L + ++ 
Sbjct: 305 YAVAQACDRGETTRKDAAGVILYTAENATQMALQAIQILGGNGYINEFPTGRLLRDAKLY 364

Query: 369 NTYEGTHDVHALILGR 384
               GT ++  +++GR
Sbjct: 365 EIGAGTSEIRRMLIGR 380


Lambda     K      H
   0.320    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 335
Number of extensions: 13
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 393
Length of database: 387
Length adjustment: 31
Effective length of query: 362
Effective length of database: 356
Effective search space:   128872
Effective search space used:   128872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory