Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate GFF4233 Psest_4306 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
Query= BRENDA::P42588 (459 letters) >lcl|FitnessBrowser__psRCH2:GFF4233 Psest_4306 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Length = 441 Score = 192 bits (488), Expect = 2e-53 Identities = 132/393 (33%), Positives = 201/393 (51%), Gaps = 39/393 (9%) Query: 79 TQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQ-ELLDPLRAMLAKTLAALT 137 + G++ +D G N GH + AV Q+AK ++ PL LA+ LAA++ Sbjct: 42 SDGRQVLDGTAGLWCCNAGHGRREISEAVSKQIAKMDFAPTFQMGHPLPFELAEKLAAIS 101 Query: 138 PGKLKYSFFCNSGTESVEAALKLAKAYQSPRGKFT---FIATSGAFHGKSLGALSATAKS 194 P L FF NSG+ES + ALK+A AYQ G+ + I A+HG G +S + Sbjct: 102 PEGLNRVFFTNSGSESADTALKIALAYQRAIGQGSRTRLIGRELAYHGVGFGGMSVGGMA 161 Query: 195 TFRKPFMPLLPGFRHVPFGNIEAMRTALN------------ECKKT-----GDDVAAVIL 237 R+ F P+LPG H+P ++ R A + E ++ +++AAVI+ Sbjct: 162 NNRRAFGPMLPGVDHLPH-TLDLQRNAFSRGLPQHGVERADELERLVTLHGAENIAAVIV 220 Query: 238 EPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILC 297 EP+ G GVILPP GYL +R++ + G L+I DEV TG GR G+ FA + V PDIL Sbjct: 221 EPMSGSAGVILPPVGYLQRLREITAKHGILLIFDEVITGFGRVGEAFAAQRWGVTPDILT 280 Query: 298 LAKALGGGVMPIGATIATEEVFSVLFDNP-----FLHTTTFGGNPLACAAALATINVLLE 352 AK L G +P+GA +A + +F P F H T+ G+P+ACAAALAT + + Sbjct: 281 CAKGLTNGAIPMGAVLAADHLFDAFMKGPESVIEFFHGYTYSGHPVACAAALATQQIYQQ 340 Query: 353 QNLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFVDN-----EIGYNFASE 407 +NL +A + L R+ P+++ + R G++ I+F + + GY E Sbjct: 341 ENLFQKAIDLEPYWQEALFSL-RDLPNVI-DIRTVGLVAGIQFAAHADGVGKRGYEVFRE 398 Query: 408 MFRQRVLVAGTLNNAKTIRIEPPLTLTIEQCEL 440 F + +LV + TI + P L +E+ E+ Sbjct: 399 CFEKGLLVRA---SGDTIALSP--ALIVEKAEI 426 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 441 Length adjustment: 33 Effective length of query: 426 Effective length of database: 408 Effective search space: 173808 Effective search space used: 173808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory