Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate GFF1859 Psest_1898 ABC-type sugar transport system, permease component
Query= reanno::Koxy:BWI76_RS01820 (296 letters) >FitnessBrowser__psRCH2:GFF1859 Length = 280 Score = 83.6 bits (205), Expect = 5e-21 Identities = 87/308 (28%), Positives = 139/308 (45%), Gaps = 49/308 (15%) Query: 5 QPKSQKLRLFTTHLLLLVFIAAIMFPLLMVIAISLREG-NFATGSLI--PESISWEHWRL 61 QP+ RL T + LL+ A + PL++++ S + + TG+L+ PE+ S W Sbjct: 6 QPRLTLGRL-TIYATLLLACAVYLVPLIVMLLTSFKTPEDIRTGNLLSWPEAFSAMGWLT 64 Query: 62 ALGFSVEHADGRVTPPPFPVLLWLWNSIKVAGITAIGIVALSTTCAYAFARMRFPGKATL 121 A + G + WNS+K+ + AL Y + RF G + L Sbjct: 65 AW----DSIGG-----------YFWNSVKIVIPAVLISTALGALNGYVLSMWRFRG-SQL 108 Query: 122 LKGMLIFQMF-PAVLSLVALYALFDRLGQYVPFVGLNTHGGVIFAYMGGIALHVWTIKGY 180 G+L+F F P + L+ +LG + T G V+ + G+A + + Sbjct: 109 FFGLLLFGCFLPFQVILLPASFTLGKLG-----LANTTTGLVLVHVVYGLAFTTLFFRNF 163 Query: 181 FETIDGSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSF------------IAAIT 228 + ++ +L AA LDGA + F +LLP+SVPI+ V I F A+ Sbjct: 164 YVSVPDALVRAARLDGAGFFTIFGRILLPMSVPIIMVCLIWQFTQIWNDFLFGVVFASGD 223 Query: 229 EVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITVVFLLAQRWLVNG 288 PV L VN+ T G +QY AAA+++ +P VV+++A ++ + G Sbjct: 224 TQPVTVALNNLVNTST---GAKQY--------NVDMAAAMIAGLPTLVVYVVAGKYFLRG 272 Query: 289 LTAGGVKG 296 LTAG VKG Sbjct: 273 LTAGAVKG 280 Lambda K H 0.328 0.141 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 280 Length adjustment: 26 Effective length of query: 270 Effective length of database: 254 Effective search space: 68580 Effective search space used: 68580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory