Align MalG, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate GFF851 Psest_0865 ABC-type maltose transport systems, permease component
Query= TCDB::Q8DT26 (278 letters) >FitnessBrowser__psRCH2:GFF851 Length = 296 Score = 133 bits (334), Expect = 5e-36 Identities = 87/293 (29%), Positives = 150/293 (51%), Gaps = 21/293 (7%) Query: 3 RKKQLQIGSIYALLILLSFIWLFPIIWVILTSFRGEGTAYVPYIIPKTWTLDNYIKLF-- 60 + + ++ + +A L+ LFP++ VI SFR EG + P+ TL+++ Sbjct: 7 KSARYRLWATHAALLAFVAAILFPLLMVISISFR-EGNFATGSLFPENPTLEHWSLALGI 65 Query: 61 ---------TNSSFPFGRWFLNTLIVSTATCVLSTSITVAMAYSLSRIKFKHRNGFLKLA 111 T FP W N++ ++ + +L ++ AY+ +R++F + LK Sbjct: 66 PYTHADGSVTQPPFPVLLWLWNSVKIAFVSSILILLLSTTSAYAFARMRFGGKAPILKSM 125 Query: 112 LVLNMFPGFMSMIAVYYILKALNL------TQTLTSLVLVYSSGAALTFYIAKGFFDTIP 165 L+ MFP +S++A+Y + L + ++++ G AL + KG+F++I Sbjct: 126 LIFQMFPPVLSLVAIYALFDQLGQHVSWLGVNSHGAVIVASLGGMALHIWTIKGYFESID 185 Query: 166 YSLDESAMIDGATRKDIFLKITLPLSKPIIVYTALLAFIAPWIDFIFAQVILGDATSKYT 225 SL+E+A++DGAT F I LP+S PI+ +LAFI ++ A V+L D K T Sbjct: 186 ASLEEAAIVDGATTWQAFFHILLPMSVPILAVVFILAFITSVTEYPIASVLLMD-VDKLT 244 Query: 226 VAIGLFSMLQADTINNWFMAFAAGSVLIAIPITILFIFMQKYYVEGITGGSVK 278 +++G L N + FAA +VL +PIT +F++ QK+ V G+T G VK Sbjct: 245 LSVGAQQYLYPQ--NYLWGDFAAAAVLSGLPITAVFLYCQKWIVGGLTAGGVK 295 Lambda K H 0.330 0.142 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 296 Length adjustment: 26 Effective length of query: 252 Effective length of database: 270 Effective search space: 68040 Effective search space used: 68040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory