Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate GFF3591 Psest_3658 spermidine/putrescine ABC transporter ATP-binding subunit
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__psRCH2:GFF3591 Length = 369 Score = 222 bits (565), Expect = 1e-62 Identities = 123/284 (43%), Positives = 172/284 (60%), Gaps = 21/284 (7%) Query: 21 VENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGNLYIDDKLMNDASPKDRDIA 80 V + NLDI EF+ +GPSG GK+T+L M+AG E T G + +D + +N+ P RD+ Sbjct: 27 VRDLNLDIRRGEFLTLLGPSGSGKTTSLMMLAGFETPTAGEILLDGRAINNVPPHKRDMG 86 Query: 81 MVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAAEILGLTEFLERKPADLSGGQ 140 MVFQNYAL+PHM+V EN+AF L +R K DI +RV A ++ L F R PA LSGGQ Sbjct: 87 MVFQNYALFPHMTVSENLAFPLSVRGMAKPDIKERVKRALAMVQLEGFRNRYPAQLSGGQ 146 Query: 141 RQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKIHRRIGATTIYVTHDQTEAM 200 +QRVA+ RA+V + ++ LMDEPL LD +LR M+ EI +H R+G T +YVTHDQ EA+ Sbjct: 147 QQRVALARALVFEPQLVLMDEPLGALDKQLREQMQMEIKHLHERLGVTVVYVTHDQGEAL 206 Query: 201 TLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANKFVAGFIGSPAMNFFEVTVEK 260 T++DR+ + G+I+QI P+ LY +P N FVA F+G E Sbjct: 207 TMSDRVAVFHQ----------GQIQQIEDPRTLYEKPVNTFVANFLG-------ENNRLP 249 Query: 261 ERLVNQDGLSLALPQGQEKILE----EKGYLGKKVTLGIRPEDI 300 L+++ G S + G+ + +E G G V+L IRPE + Sbjct: 250 AHLLDRRGDSCTVKLGRGETVEALAVNVGAAGTPVSLSIRPERV 293 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 369 Length adjustment: 30 Effective length of query: 347 Effective length of database: 339 Effective search space: 117633 Effective search space used: 117633 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory