GapMind for catabolism of small carbon sources

 

Aligments for a candidate for susB in Pseudomonas stutzeri RCH2

Align Probable alpha-glucosidase; EC 3.2.1.20 (uncharacterized)
to candidate GFF2114 Psest_2157 trehalose synthase

Query= curated2:Q9Z3R8
         (551 letters)



>lcl|FitnessBrowser__psRCH2:GFF2114 Psest_2157 trehalose synthase
          Length = 1108

 Score =  259 bits (663), Expect = 3e-73
 Identities = 199/597 (33%), Positives = 286/597 (47%), Gaps = 112/597 (18%)

Query: 17  WWRGAVIYQIYPRSFQDTNGDGIGDLQGITARLPHIAGLGADAIWISPFFTSPMRDFGYD 76
           W++ AV+YQ++ +SF D+N DG+GD  G+  +L +IA LG + IW+ PF+ SP RD GYD
Sbjct: 16  WYKDAVVYQVHLKSFYDSNNDGVGDFAGLIDKLDYIADLGVNTIWLLPFYPSPRRDDGYD 75

Query: 77  VSNYVDVDPIFGTLEDFDALIAEAHRLGLRVMIDLVLSHTSDRHPWFVESRSSRSNAKA- 135
           +++Y  V P +GT+ D    IAEAH+ GLRV+ +LV++HTSD+HPWF  +R +R  + A 
Sbjct: 76  IADYRGVHPEYGTMADARRFIAEAHKRGLRVITELVINHTSDQHPWFQRARKARKGSAAR 135

Query: 136 DWYVWADS--KPDGTPPNNWLSIF---GGSAWQWDPTRLQYYLHNFLTSQPDLNLHNPQV 190
           ++YVW+D+  K DGT       IF     S W WDP   QY+ H F + QPDLN  NPQV
Sbjct: 136 NFYVWSDTDEKYDGT-----RIIFLDTEKSNWTWDPVAKQYFWHRFYSHQPDLNFDNPQV 190

Query: 191 QEALLAVERFWLERGVDGFRLDTINFYFHDRELRDNPALVPERRNASTAPAVNPYNYQEH 250
            +A+LAV R+WL+ G+DG RLD I  Y  +R+  +N                        
Sbjct: 191 MKAVLAVMRYWLDMGIDGLRLDAIP-YLVERDGTNN------------------------ 225

Query: 251 IYDKNRPENLEFLKRFRAVMD-EFPAIAAVGEVGD--SQRGLEIAGEYTSGGDKVHMCYA 307
              +N PE    LK  RA +D  +P    + E         L   GE    GD+ HM + 
Sbjct: 226 ---ENLPETHAVLKAIRAEIDANYPDRMLLAEANQWPEDTQLYFGGEDGGPGDECHMAFH 282

Query: 308 FEFLAPDRLT-PQRVAEVLRDFHRAAPE-----GWACWAFSNHD-----VVRHVSR---W 353
           F  +    +   Q     + D  R  P+      WA +   NHD     +V    R   W
Sbjct: 283 FPLMPRMYMAIAQEDRFPITDILRQTPDIPENCQWAIF-LRNHDELTLEMVTDRERDYLW 341

Query: 354 ADGVTDHDA-------------------HAKLLASLLMSLRGTVCIYQGEELALAEAELD 394
               +D  A                     +LL SLL+S+ GT  IY G+E+ +     D
Sbjct: 342 NYYASDKRARINLGIRRRLAPLLERDRRRIELLNSLLLSMPGTPVIYYGDEIGMG----D 397

Query: 395 YEDLQDPYGIQFWPDFKGRDGCRTPMVWESLPDGGFSSATP----WLPISQ---SHIPRA 447
              L D            RDG RTPM W    +GGFS A P      P+      +    
Sbjct: 398 NIFLGD------------RDGVRTPMQWSVDRNGGFSRADPPNLVLPPVMDPLYGYYTIN 445

Query: 448 VAVQEGDPASVLHHYRRFLAFRKANPALAKGEIEFV-ETRGSLLGFLR-----SHGNEKV 501
           V  Q+ DP S+L+  RR L  RK   A  +G ++ +  +   +L +LR     +   E +
Sbjct: 446 VEAQQRDPHSLLNWTRRMLTIRKQFKAFGRGTLKMLAPSNRRILAYLREFTGANGDTEII 505

Query: 502 FCLFNMSDEAATKELPMKR------LEPLEGHGFVS-EILDHEVKLPAWGAFFARLA 551
           FC+ N+S  A   EL M +      +E + G  F     L + + LP +G ++ +LA
Sbjct: 506 FCVANVSRSAQAAELEMSQYAGMVPVEMVGGSAFPPIGQLPYLLTLPPYGFYWFQLA 562


Lambda     K      H
   0.321    0.138    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1578
Number of extensions: 89
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 551
Length of database: 1108
Length adjustment: 41
Effective length of query: 510
Effective length of database: 1067
Effective search space:   544170
Effective search space used:   544170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory