Align ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized)
to candidate GFF4209 Psest_4282 spermidine/putrescine ABC transporter ATP-binding subunit
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3039 (367 letters) >FitnessBrowser__psRCH2:GFF4209 Length = 383 Score = 226 bits (576), Expect = 8e-64 Identities = 132/334 (39%), Positives = 200/334 (59%), Gaps = 20/334 (5%) Query: 4 LKIKNLQKGFEGFSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSGGTIELD 63 LKI + K F+ + + L ++ E +G SG GKSTLLR++AG E + G I LD Sbjct: 23 LKIDRVTKKFDETVAVDDVSLSIHQGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLD 82 Query: 64 GRDITEVSPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVAKAEVEKKVSEAARILEL 123 G+DIT++ P +R + M+FQ+YAL+PHM+V +N++F L G+ KAE+E++V E ++++ Sbjct: 83 GQDITDMPPYERPINMMFQSYALFPHMTVEQNIAFGLKQDGLPKAEIEERVKEMLGLVQM 142 Query: 124 GPMLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELLRLHKEL 183 +RKP QLSGGQRQRVA+ R++ + PK+ L DEP+ LD LR QM+LEL+++ + + Sbjct: 143 TQYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVQIIERV 202 Query: 184 QATMIYVTHDQVEAMTMADKVVVLNGGKIEQVGSPLDLYHQPANLFVAGFLGTPKM--GF 241 T + VTHDQ EAMTMA+++ +++ G I QVGSP+D+Y PA+ V F+G + G Sbjct: 203 GVTCVMVTHDQEEAMTMAERIAIMHLGWIAQVGSPMDIYETPASRLVCEFIGNVNLFDGE 262 Query: 242 L---KGKITRVDSQGCEVQLDAGTRVSLPLGGRHLSVGSAVTLGIRPEHL-------ELA 291 L G + S G E + G +S + +T IRPE L EL Sbjct: 263 LIEDMGDHAVIASPGLENPIYVGHGISTRAEDKQ------ITYAIRPEKLLIGTELPELE 316 Query: 292 KPG-DCALQVTADVSERLGSDTFCHVRTASGEAL 324 +PG + A V D++ LG + +++ SG L Sbjct: 317 RPGYNWAKGVVHDIA-YLGGHSVYYIKLPSGGVL 349 Lambda K H 0.320 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 383 Length adjustment: 30 Effective length of query: 337 Effective length of database: 353 Effective search space: 118961 Effective search space used: 118961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory