Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate GFF2021 Psest_2064 ABC-type uncharacterized transport system, duplicated ATPase component
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__psRCH2:GFF2021 Length = 553 Score = 243 bits (619), Expect = 1e-68 Identities = 123/260 (47%), Positives = 183/260 (70%), Gaps = 8/260 (3%) Query: 12 PLLQTVDLKKYFPQGKRIL-------KAVDGISIEIKEGETLGLVGESGCGKSTLGRTIL 64 PLL+ DL+ +FP K +L KAVDG++ + +G+TLG+VGESG GKSTLG IL Sbjct: 278 PLLEVDDLRVWFPIKKGLLRRTVDHIKAVDGVNFSLPKGQTLGIVGESGSGKSTLGLAIL 337 Query: 65 KLLRPDGGKIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIH 124 +LL G+I F+G+ + +++ ++++P R++MQ++FQDP GSL+P+M+VG+I+ + L IH Sbjct: 338 RLLG-SRGEIRFQGQHLQSMSQRQVRPLRRQMQVVFQDPFGSLSPRMSVGQIVGEGLHIH 396 Query: 125 KIGTKKERRKRVEELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPV 184 ++G KE+ + + E L VG+ E + +PHEFSGGQ+QRI IARAL L P I+ DEP Sbjct: 397 RMGNAKEQEQAIIEALVEVGLDPETRHRYPHEFSGGQRQRIAIARALVLKPALILLDEPT 456 Query: 185 SALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKI 244 SALD ++Q Q+++LL +Q K ++YLFI+H+LAVV +SH++ V+ G++VE G I Sbjct: 457 SALDRTVQRQVVELLRSLQAKYNLTYLFISHDLAVVRALSHQMMVVKQGQVVEQGAAADI 516 Query: 245 FLNPIHPYTRALLKSVPKIP 264 F P HPYT+ LL+S P Sbjct: 517 FAAPQHPYTQQLLESAFMAP 536 Score = 206 bits (525), Expect = 8e-58 Identities = 110/257 (42%), Positives = 171/257 (66%), Gaps = 8/257 (3%) Query: 13 LLQTVDLKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLL----- 67 L++ DL F G+++ + V+G++ +I++GETL LVGESG GKS +IL+LL Sbjct: 10 LVEVRDLAVEFVTGEQVQRVVEGVTFDIRKGETLALVGESGSGKSVTAHSILRLLPYPLA 69 Query: 68 RPDGGKIFFEGKDITNLNDKEMKPYR-KKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKI 126 R G+I F G+D+ ++K M+ R ++ ++FQ+P+ SLNP TVG+ I + L IHK Sbjct: 70 RHPQGQILFHGQDLLKADEKAMRKIRGNRIAMVFQEPMTSLNPLHTVGKQINEVLEIHKG 129 Query: 127 GTKKERRKRVEELLDMVGIG--REFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPV 184 K R ELL++VGI R+ I ++PHE SGGQ+QR+ IA ALA P+ ++ DEP Sbjct: 130 LRGKAATARTLELLELVGIPEPRKRIRAYPHELSGGQRQRVVIAMALANEPELLIADEPT 189 Query: 185 SALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKI 244 +ALDV++Q +I++LL+E+Q ++G++ L I+H+L +V I+H+V VM G++VE + + Sbjct: 190 TALDVTVQLKILELLKELQARLGMALLLISHDLNLVRRIAHRVCVMQRGRVVEQALCEDL 249 Query: 245 FLNPIHPYTRALLKSVP 261 F P HPYT+ LL + P Sbjct: 250 FRAPQHPYTQELLAAEP 266 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 538 Number of extensions: 22 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 328 Length of database: 553 Length adjustment: 32 Effective length of query: 296 Effective length of database: 521 Effective search space: 154216 Effective search space used: 154216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory