Align BadK (characterized)
to candidate GFF3051 Psest_3109 Enoyl-CoA hydratase/carnithine racemase
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__psRCH2:GFF3051 Length = 272 Score = 127 bits (319), Expect = 2e-34 Identities = 92/263 (34%), Positives = 132/263 (50%), Gaps = 13/263 (4%) Query: 3 SNPILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGN-TRAF 61 ++ + E G +IT+N P N + + L + + DD I A+VI+G + F Sbjct: 16 THKLTVEKHGHTALITINHPPA-NTWDRESLIGLKQVVEHLNHDDDIYALVISGQGEKFF 74 Query: 62 AAGADIASMA------AWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELAL 115 +AGAD+ A A + +G F E +R R +AA+ G A GGG E AL Sbjct: 75 SAGADLKLFADGDRNRAREMARRFGEAF-----EALRDFRGVSIAAINGFALGGGLECAL 129 Query: 116 ACDIVIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYG 175 ACD+ IA + A+ LPE +GLLP AGGTQ L +G+ A M L + AE A R G Sbjct: 130 ACDLRIAEQQAQMGLPEASVGLLPCAGGTQALAWLVGEGWAKRMILCGERITAETALRIG 189 Query: 176 LVSRVVDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARF 235 L+ +VV+ + R + LA IA S A+ A+K ++ A + ER F Sbjct: 190 LIEQVVEPGQARGHALLLAARIARQSPVAVRAIKPLIDGARQRLPHTFGAAEREAFVELF 249 Query: 236 ASADAREGIQAFLEKRAPCFSHR 258 + D EG+ AFLEKR P + +R Sbjct: 250 EAEDTLEGVNAFLEKRDPRWRNR 272 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 272 Length adjustment: 25 Effective length of query: 233 Effective length of database: 247 Effective search space: 57551 Effective search space used: 57551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory