Align crotonase (EC 4.2.1.150) (characterized)
to candidate GFF2033 Psest_2076 Enoyl-CoA hydratase/carnithine racemase
Query= metacyc::MONOMER-13469 (259 letters) >FitnessBrowser__psRCH2:GFF2033 Length = 270 Score = 134 bits (336), Expect = 3e-36 Identities = 84/266 (31%), Positives = 136/266 (51%), Gaps = 11/266 (4%) Query: 2 EFKNIILEKDGNVASITLNRPKALNALNAATLKEIDAAINDIAEDDNVYAVIITGSGKAF 61 E+K +E +A + +NRP+ +NA++AA EI N + D V V+++G+G+ F Sbjct: 3 EYKAFRVELADKIARVVINRPEKINAMDAAFWSEIIDIFNWVDATDEVRVVVLSGAGEHF 62 Query: 62 VAGADIAEMKDLTAVEGRKFSVLGNKIFRKLENLE----------KPVIAAINGFALGGG 111 +G D+ + + + G ++ RK+ +L+ KPVIAAI G+ LGG Sbjct: 63 SSGIDLQLLASVGSQLGNDVGRNAERLRRKILSLQASFNAVDHCRKPVIAAIQGYCLGGA 122 Query: 112 CELSLSCDIRIASSKAKFGQPEVGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEE 171 +L +CD+R +++ AKF E+ +G+ G QRL R IG GM +EL +TG+ I+ EE Sbjct: 123 IDLISACDMRYSTASAKFSIKEIDMGMAADVGTLQRLPRIIGDGMMRELAFTGRTIDGEE 182 Query: 172 ALRIGLVNKV-VEPDKLLEEAKALVDAIIVNAPIAVRMCKAAINQGLQCDIDTGVAYEAE 230 A IGLVN+ + L++ L I +P+A+R K I +D G+ Y A Sbjct: 183 ARSIGLVNRTYADQQALMDGVLELARDIARKSPVAIRGTKEMIRYMRDHRVDDGLEYIAT 242 Query: 231 VFGECFATEDRVEGMTAFVEKRDKAF 256 + D + A + K+ F Sbjct: 243 WNAAMLQSADIKVAIAAHMSKQKPDF 268 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 270 Length adjustment: 25 Effective length of query: 234 Effective length of database: 245 Effective search space: 57330 Effective search space used: 57330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory