Align phenylpyruvate decarboxylase (EC 4.1.1.43) (characterized)
to candidate GFF1392 Psest_1429 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit
Query= BRENDA::A0A222AKA3 (368 letters) >FitnessBrowser__psRCH2:GFF1392 Length = 329 Score = 154 bits (390), Expect = 2e-42 Identities = 103/298 (34%), Positives = 151/298 (50%), Gaps = 26/298 (8%) Query: 41 RQLLMYRAMVVGRAFNRQATAFSRQGRLAVYPS-----------SRGQEACQVGSALAVR 89 ++L MY M+ R +G+ V+ S GQE C VG + Sbjct: 8 QRLWMYEQMLTSRYMEESIERIYMEGKTPVFNMAKGPIPGEMHLSNGQEPCAVGVCAHLE 67 Query: 90 PTDWLFPTYRESVALLTRGIDPVQVLTLF----------RGDQHCGYDPVTEHTAPQCTP 139 D + T+R + +G+D +++ RG +D + C+ Sbjct: 68 AEDIVTATHRPHHIAVAKGVDLNEMMAEIFGKATGLSGGRGGHMHLFDGRVNFS---CSG 124 Query: 140 LATQCLH-AAGLADAARMAGDPIVALAYIGDGATSEGDFHEALNYAAVRRAPVVFLVQNN 198 + + + A G A + +M G P VA+++IG+GA ++G FHE LN AA+ + PVVF++++N Sbjct: 125 IIAEGMGPAVGAALSRQMQGKPGVAVSFIGEGAANQGAFHETLNLAALWKLPVVFVIEDN 184 Query: 199 QYAISVPLAKQTAARTLADKAAGYGMPGVRIDGNDVLQVYRAVHDAAERARAGHGPTLIE 258 + ISV A T +AA YGMPGV ++ ND V+RA +A ERARAG GPTLIE Sbjct: 185 AWGISVAKASATCIAQHHVRAAAYGMPGVFVENNDPDGVFRAAGEAIERARAGGGPTLIE 244 Query: 259 AVTYRIDAHTNADDDTRYRPAGEADVWAAQDPVDRLERDLLAAGVLDRAAADGIAAAA 316 TYR+ H D +T YRP GE D +DP+ + L+ GVL A A+ IAA A Sbjct: 245 IETYRLAGHFMGDGET-YRPEGEKDGLIKKDPIPGYRQRLIDEGVLSEAQAEDIAARA 301 Lambda K H 0.319 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 329 Length adjustment: 29 Effective length of query: 339 Effective length of database: 300 Effective search space: 101700 Effective search space used: 101700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory