Align phenylpyruvate decarboxylase (EC 4.1.1.43) (characterized)
to candidate GFF2176 Psest_2219 pyruvate dehydrogenase E1 component, alpha subunit
Query= BRENDA::A0A222AKA3 (368 letters) >FitnessBrowser__psRCH2:GFF2176 Length = 330 Score = 130 bits (327), Expect = 5e-35 Identities = 94/294 (31%), Positives = 138/294 (46%), Gaps = 13/294 (4%) Query: 33 AAAGVPPDRQLLMYRAMVVGRAFNRQATAFSRQGRLAVYPSSR-GQEACQVGSALAVRPT 91 A PP+ L + R M+ R +A +G++ + G+EA VG+ A+ Sbjct: 5 ATLSYPPELALNLLRDMLRVRIMEERAAELYGEGKIRGFLHLYIGEEAVAVGALHALAAD 64 Query: 92 DWLFPTYRESVALLTRGIDPVQVLTLFRGDQH-CG---------YDPVTEHTAPQCTPLA 141 D + TYRE L +G+ ++ G Q C +D T Sbjct: 65 DAIVATYREHGHALIQGVSMRAIMAEMYGRQQGCSGGRGGSMHLFDAGTRFFGGNAIVGG 124 Query: 142 TQCLHAAGLADAARMAGDPIVALAYIGDGATSEGDFHEALNYAAVRRAPVVFLVQNNQYA 201 L A GLA A +M V+ + G+GA +EG FHE++N AA+ + PV+F +NN YA Sbjct: 125 GLPL-AVGLALAEQMRQGTRVSACFFGEGAMAEGAFHESMNLAALWQLPVLFCCENNLYA 183 Query: 202 ISVPLAKQTAARTLADKAAGYGMPGVRIDGNDVLQVYRAVHDAAERARAGHGPTLIEAVT 261 + LA+ + L KAA Y + +DG DV+ V+ A A E R+G GP +E T Sbjct: 184 MGTALARSQSQTDLCAKAAAYRVAARAVDGMDVVAVHDATRAAVEHVRSGQGPYFLELQT 243 Query: 262 YRIDAHTNADDDTRYRPAGEADVWAAQDPVDRLERDLLAAGVLDRAAADGIAAA 315 YR AH+ D + YR E ++W +DP+ L A G+LD A I AA Sbjct: 244 YRFRAHSMFDPEL-YRDKAEVELWKQRDPIHSYSVRLQAQGLLDAAGLLAIEAA 296 Lambda K H 0.319 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 330 Length adjustment: 29 Effective length of query: 339 Effective length of database: 301 Effective search space: 102039 Effective search space used: 102039 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory