Align dihydromonapterin reductase (EC 1.5.1.50) (characterized)
to candidate GFF3145 Psest_3204 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= BRENDA::P0AFS3 (240 letters) >FitnessBrowser__psRCH2:GFF3145 Length = 234 Score = 196 bits (499), Expect = 3e-55 Identities = 110/232 (47%), Positives = 142/232 (61%), Gaps = 3/232 (1%) Query: 8 PILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLINAGAQCIQADFSTNDGVMA 67 PILITG +RIGL A + VIV+YR +ID L GA ++ADFS G+ Sbjct: 5 PILITGASQRIGLHCAERLLEDGFTVIVTYRRERDSIDRLRTLGASTLKADFSDEAGITG 64 Query: 68 FADEVLKSTHGLRAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGH 127 F + + T LRAI+HNAS W + PG A+ + Q+H+ PYL+N LLR Sbjct: 65 FIAALREQTASLRAIVHNASEWRPDTPGQE-AEAFRQLFQVHMLAPYLINLHCADLLRHG 123 Query: 128 GHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIAPSLILFN 187 G A DI+H D V +GS KHIAYAASKA LDN+T SFA LAP +KVN IAP+LI FN Sbjct: 124 GPA--DIVHIGDDVTRKGSKKHIAYAASKAGLDNLTLSFAASLAPAIKVNGIAPALIQFN 181 Query: 188 EHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHL 239 DD EYR++AL KS + PG + + + YLL + +VTG + ++GGRHL Sbjct: 182 PDDDEEYRRKALAKSALGIEPGAEVIYQSLRYLLDNPYVTGTTLTVNGGRHL 233 Lambda K H 0.322 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 234 Length adjustment: 23 Effective length of query: 217 Effective length of database: 211 Effective search space: 45787 Effective search space used: 45787 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory