Align BadK (characterized)
to candidate GFF4162 Psest_4235 3-hydroxyacyl-CoA dehydrogenase
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__psRCH2:GFF4162 Length = 701 Score = 121 bits (303), Expect = 5e-32 Identities = 73/180 (40%), Positives = 99/180 (55%), Gaps = 14/180 (7%) Query: 9 ETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGADIA 68 E QG + +IT+N P V NAL A+ + L A + +AD + A+ + F AGADI Sbjct: 8 EVQGEIALITVNNPPV-NALGQAVREGLQKAFQSAEADPQVRAVALVCEGNTFIAGADIK 66 Query: 69 SMA----AWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGR 124 A S +V E I K +A + G A GGG E+AL C IA + Sbjct: 67 EFGKPPQAPSLPEVI---------EIIEACNKSSVAVIHGTALGGGLEVALGCHYRIARK 117 Query: 125 SAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDD 184 AK LPE+KLGLLPGAGGTQRLPR G KA++M +S +P++A EA + +V + + D Sbjct: 118 DAKVGLPEVKLGLLPGAGGTQRLPRLAGVEKALEMIVSGQPISAAEAVEHNIVDELFEGD 177 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 701 Length adjustment: 32 Effective length of query: 226 Effective length of database: 669 Effective search space: 151194 Effective search space used: 151194 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory