Align NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate GFF1278 Psest_1311 Branched-chain amino acid ABC-type transport system, permease components
Query= TCDB::P74318 (286 letters) >FitnessBrowser__psRCH2:GFF1278 Length = 307 Score = 145 bits (365), Expect = 1e-39 Identities = 87/294 (29%), Positives = 161/294 (54%), Gaps = 21/294 (7%) Query: 5 QLIFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAYLTWWANTSGINLWL-SM 63 Q + NG+ VGS AL A+G T+ YGI+ + NFAHG+ + +Y+T+ A + L ++ Sbjct: 9 QQLINGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVTFIAIVGLSMMGLDAL 68 Query: 64 ALGCVGTIIAMFIG--------EWLLWKPMRARRATATTLIIISIGLALFLRNGILLIWG 115 + +G +A I E + ++P+R +I +IG+++FL+N +LL Sbjct: 69 PILMIGAFVAAMIVTSAYGYSIERVAYRPLRGSNRLIP--LISAIGMSIFLQNVVLL--A 124 Query: 116 GNNQNYRVP-------IVPAQDFMGIKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMR 168 ++++ +P ++ G+ Y ++L+ + AM L L + R+++G+A R Sbjct: 125 QDSKDKAIPNLMPGNLVIGESAMNGVVISYMQILIFVVTFVAMYGLTLFISRSRLGRACR 184 Query: 169 AVADNVDLAKVSGINVEWVVMWTWVMTAVLTALGGSMYGLMT-TLKPNMGWFLILPMFAS 227 A A+++ +A + GIN ++ T+V+ A L A+ + + + P++G+ + F + Sbjct: 185 ACAEDLKMANLLGINTNSIIALTFVIGAALAAVAAVLISMQYGVINPHIGFLAGIKAFTA 244 Query: 228 VILGGIGNPYGAIAGGIIIGVAQEVSVPWFGTSYKMGVALLLMIIILFIRPQGL 281 +LGGIG+ GA+ GG+++GVA+ FG YK VA L+I++L RP G+ Sbjct: 245 AVLGGIGSIPGAMLGGLVLGVAEAFGADIFGDQYKDVVAFSLLILVLLFRPTGI 298 Lambda K H 0.329 0.143 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 307 Length adjustment: 26 Effective length of query: 260 Effective length of database: 281 Effective search space: 73060 Effective search space used: 73060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory