Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate GFF2604 Psest_2654 fatty oxidation complex, alpha subunit FadB
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__psRCH2:GFF2604 Length = 715 Score = 118 bits (296), Expect = 3e-31 Identities = 73/219 (33%), Positives = 113/219 (51%), Gaps = 12/219 (5%) Query: 23 DKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFCAGADITQFN---QLTPAEAW 79 + +N N L +L +AV ++D ++ +I+T F GADIT+F ++ E Sbjct: 27 ESVNKFNRLTLNDLRQAVDAIKADASVKGVIVTSGKDVFIVGADITEFVDNFKMADEELV 86 Query: 80 KFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAAEEAQLGLPEINLGIY 139 + + +I E L PT+A ING ALGGG E+ +A D R+ + A++GLPE+ LGIY Sbjct: 87 AGNLEANKIFSDFEDLGVPTVAAINGIALGGGFEMCMAADYRVMSTTAKVGLPEVKLGIY 146 Query: 140 PGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLEQETRKLAEKIA 199 PG+GGT RL R+IG A+E + +G +DA K V+ VV L+ L ++ Sbjct: 147 PGFGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVHAVDAVVAPDKLQAAALDLVKR-- 204 Query: 200 KKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFST 238 A+ E+ + P L L L ++ + F T Sbjct: 205 -------AISGELDYKAKRQPKLDKLKLNAIEQMMAFET 236 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 715 Length adjustment: 32 Effective length of query: 227 Effective length of database: 683 Effective search space: 155041 Effective search space used: 155041 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory