Align 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 (characterized)
to candidate GFF2519 Psest_2567 PEP phosphonomutase and related enzymes
Query= SwissProt::P77541 (296 letters) >FitnessBrowser__psRCH2:GFF2519 Length = 278 Score = 65.9 bits (159), Expect = 1e-15 Identities = 52/166 (31%), Positives = 80/166 (48%), Gaps = 8/166 (4%) Query: 27 NANHALLAQRAGYQAIYLSGGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVDA 86 +A A + G++A+ + G A S D G D VL +R + +LP+ D Sbjct: 29 DAGSAAVLAAMGFKALATTSSGYA-WSCARAD-GQMARDAVLAHMRGMVQATALPVNGDF 86 Query: 87 DIGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVD 146 + GF + VA +V+ ++ G AG+ IED G R P + I E + R A+D Sbjct: 87 ESGFAETPEGVAESVRMAVETGIAGISIEDSTGDPR---EPLREISQATERMYAAREAID 143 Query: 147 AKTDPDFVIMARTDALAV--EGLDAAIERAQAYVEAGAEMLFPEAI 190 A T + +++ R + V LD I+R QAY EAGA+ L+ I Sbjct: 144 A-TGGETLLIGRAENFFVGRPDLDDTIQRLQAYAEAGADCLYAPGI 188 Lambda K H 0.319 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 278 Length adjustment: 26 Effective length of query: 270 Effective length of database: 252 Effective search space: 68040 Effective search space used: 68040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory