Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate GFF1860 Psest_1899 ABC-type sugar transport systems, ATPase components
Query= CharProtDB::CH_024626 (378 letters) >FitnessBrowser__psRCH2:GFF1860 Length = 390 Score = 242 bits (617), Expect = 1e-68 Identities = 129/289 (44%), Positives = 190/289 (65%), Gaps = 7/289 (2%) Query: 18 VQLAGIRKCFDGKEV--IPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIM 75 ++L ++K + ++ + + L I+ GEFL L+GPSGCGK+T++ IAGLE + G I+ Sbjct: 4 LELRNVQKSYGNSQIATLKDIALKIDAGEFLILVGPSGCGKSTLMNCIAGLENITGGEIL 63 Query: 76 LDNEDITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVMEALRMV 135 +D EDI+ ++R + VFQSYAL+P M+V +N+AFGL+M+K PAA+I V +++ Sbjct: 64 VDGEDISQASPKDRDIAMVFQSYALYPTMSVRDNIAFGLKMRKVPAAKIEEEVARVAKLL 123 Query: 136 QLETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQR 195 Q+E +RKP QLSGGQQQRVA+ RA+ +P++ L DE LS LD KLR +M+ E+K + + Sbjct: 124 QIEPLLERKPSQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEIKLMHQ 183 Query: 196 KLGITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEINM-F 254 +L T V+VTHDQ EA+T+ D++ VM+DG I+Q GTP EIY P NLFVA FIG M F Sbjct: 184 RLKTTTVYVTHDQIEAMTLGDKVAVMKDGVIQQFGTPHEIYNNPANLFVASFIGSPPMNF 243 Query: 255 NATVIERLDEQRVRA-NVEGRECNIYVNFAVEPG---QKLHVLLRPEDL 299 I + D + V N E C + + + G ++L + +RPE + Sbjct: 244 VPLRIRQRDGRWVGVLNSEQGSCELPLPITSDDGLRDRELILGIRPEQI 292 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 390 Length adjustment: 30 Effective length of query: 348 Effective length of database: 360 Effective search space: 125280 Effective search space used: 125280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory