Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate GFF4209 Psest_4282 spermidine/putrescine ABC transporter ATP-binding subunit
Query= TCDB::P31134 (377 letters) >FitnessBrowser__psRCH2:GFF4209 Length = 383 Score = 434 bits (1116), Expect = e-126 Identities = 234/361 (64%), Positives = 277/361 (76%), Gaps = 5/361 (1%) Query: 19 LLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIML 78 LL+I +TK +D AVDDVSL+I++GEIFALLG SG GKSTLLRMLAGFE+P+ G+I L Sbjct: 22 LLKIDRVTKKFDETVAVDDVSLSIHQGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFL 81 Query: 79 DGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLVH 138 DG D++ +PPY RPINMMFQSYALFPHMTVEQNIAFGLKQD LPKAEI RV EMLGLV Sbjct: 82 DGQDITDMPPYERPINMMFQSYALFPHMTVEQNIAFGLKQDGLPKAEIEERVKEMLGLVQ 141 Query: 139 MQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILER 198 M ++AKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLR +MQLE+V I+ER Sbjct: 142 MTQYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVQIIER 201 Query: 199 VGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEG 258 VGVTCVMVTHDQEEAMTMA RIAIM+ G Q+G P +IYE P +R EFIG+VN+F+G Sbjct: 202 VGVTCVMVTHDQEEAMTMAERIAIMHLGWIAQVGSPMDIYETPASRLVCEFIGNVNLFDG 261 Query: 259 VLKERQEDGLVLDSPGLVHPLKVDADASV-VDNVPVHVALRPEKIMLCEEPP---ANGCN 314 L E D V+ SPGL +P+ V S ++ + A+RPEK+++ E P G N Sbjct: 262 ELIEDMGDHAVIASPGLENPIYVGHGISTRAEDKQITYAIRPEKLLIGTELPELERPGYN 321 Query: 315 FAVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPTWGDEVRLCWEVDSCVV 374 +A G V IAYLG SVY+++L SG ++ A + N RH K LPTW +EV + W DS VV Sbjct: 322 WAKGVVHDIAYLGGHSVYYIKLPSGGVLQAFMANTERHVK-LPTWEEEVYVYWWDDSGVV 380 Query: 375 L 375 L Sbjct: 381 L 381 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 383 Length adjustment: 30 Effective length of query: 347 Effective length of database: 353 Effective search space: 122491 Effective search space used: 122491 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory