Align putrescine transport system permease protein PotH (characterized)
to candidate GFF4208 Psest_4281 ABC-type spermidine/putrescine transport system, permease component I
Query= CharProtDB::CH_088338 (317 letters) >FitnessBrowser__psRCH2:GFF4208 Length = 298 Score = 375 bits (963), Expect = e-109 Identities = 173/289 (59%), Positives = 236/289 (81%) Query: 25 MKHGRKLVIALPYIWLILLFLLPFLIVFKISLAEMARAIPPYTELMEWADGQLSITLNLG 84 + GR+LVI +P++WL L FLLPF IV KIS AE AIPPYT++ +AD QL + +NLG Sbjct: 6 LNSGRRLVIGVPFLWLFLFFLLPFAIVLKISFAEADVAIPPYTDIFAYADQQLQVLINLG 65 Query: 85 NFLQLTDDPLYFDAYLQSLQVAAISTFCCLLIGYPLAWAVAHSKPSTRNILLLLVILPSW 144 N++ L++D LY AYL SL++A ST CLLIGYP+A+A+A ++ + + LLL+++P+W Sbjct: 66 NYIFLSEDELYLAAYLGSLRIAFFSTLLCLLIGYPMAYAIARARKDLQTVFLLLIMMPTW 125 Query: 145 TSFLIRVYAWMGILKNNGVLNNFLLWLGVIDQPLTILHTNLAVYIGIVYAYVPFMVLPIY 204 T+ LIRVYAWMGIL +NG+LN+ LL +G+ID PL IL+T++AVYIG+VY+Y+PFM+LP+Y Sbjct: 126 TAILIRVYAWMGILSSNGLLNSLLLGMGLIDTPLQILNTDIAVYIGVVYSYLPFMILPLY 185 Query: 205 TALIRIDYSLVEAALDLGARPLKTFFTVIVPLTKGGIIAGSMLVFIPAVGEFVIPELLGG 264 L++ D SL+EAA DLGAR L +F+ + VPL+K GIIAG MLVFIP VGEFVIPELLGG Sbjct: 186 ANLVKHDPSLLEAASDLGARNLTSFWKITVPLSKNGIIAGCMLVFIPVVGEFVIPELLGG 245 Query: 265 PDSIMIGRVLWQEFFNNRDWPVASAVAIIMLLLLIVPIMWFHKHQQKSV 313 P+++MIG+VLWQEFFNNRDWPVASA+A++ML +L++PI+ F+++Q K + Sbjct: 246 PETLMIGKVLWQEFFNNRDWPVASALAVVMLAILLIPIILFNRNQAKEL 294 Lambda K H 0.328 0.144 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 298 Length adjustment: 27 Effective length of query: 290 Effective length of database: 271 Effective search space: 78590 Effective search space used: 78590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory