Align Alr3027 protein, component of The 2-oxo monocarboxylate transporter (Pernil et al., 2010). Transports pyruvate which is inhibited by various 2-ketoacids (characterized)
to candidate GFF1039 Psest_1072 TRAP transporter, DctM subunit
Query= TCDB::Q8YSQ7 (445 letters) >FitnessBrowser__psRCH2:GFF1039 Length = 456 Score = 383 bits (984), Expect = e-111 Identities = 205/442 (46%), Positives = 294/442 (66%), Gaps = 13/442 (2%) Query: 12 MFAGALVLLSSGYPVAFSLGGVAILFGLLGIGLGV-FDPIF-------LTAMPQRIFGIM 63 MFA + LL G+PVA+SL G+ +LF +LG L FD + + RI+GI+ Sbjct: 11 MFASFMGLLLLGFPVAWSLAGIGLLFAVLGYVLVEHFDANLWFTWDGTIGVLDARIYGIV 70 Query: 64 ANYTLLAIPYFIFMGAMLEKSGIAERLLETMGILLGRLRGGLALAVVLVGALLAATTGVV 123 AN ++A+P FIFMG ML++SGIAERL+ ++ +LG LRGG A+ VV+VG LLAA+TG+V Sbjct: 71 ANELMVALPLFIFMGIMLDRSGIAERLMHSLVRVLGPLRGGYAVTVVVVGILLAASTGIV 130 Query: 124 AATVVAMGLISLPIMLRYGYNKELATGVIAASGTLGQIIPPSVVLVVLGDQLGIS---VG 180 A+V +G++S+ ML+ YNK LA G + GTLG +IPPS++LV++ D+LG S VG Sbjct: 131 GASVALLGMLSIGPMLQANYNKSLAVGTACSVGTLGILIPPSIMLVLMADRLGTSEASVG 190 Query: 181 DLFIGSVIPGLMMASAFALHVLIVAFIRPDVAPALPAQVREIGGKALGKRVIQVMIPPLI 240 LF+G++IPG+M+A + L+++IVA+++ D APA P ++ +AL V ++PPL Sbjct: 191 KLFMGALIPGMMLALMYILYIVIVAWLKKDFAPA-PVNRPKLDARAL-LDVFWAVVPPLA 248 Query: 241 LILLVLGSIFFGFATPTEAGAVGCAGAIALAAANGQFTLESLRQVCDTTLRITSMVVFIL 300 LI VLGSIFFG AT TEA AVG GA+ +AAA+ + L L+ T R + + I Sbjct: 249 LIFAVLGSIFFGIATTTEASAVGAFGALLMAAASRRLNLPVLKDALYQTSRTAAFIFGIF 308 Query: 301 IGSTAFSLVFRGLNGDQFMFDVLANLPGGKIGFLFVSMTTVFLLGFFIDFFEIAFIVIPL 360 IG+T F+ V RGL GD + L LP G+ G L + FLLGFF+D+ EI I++PL Sbjct: 309 IGATVFAAVLRGLGGDDVIRAALTGLPFGQTGVLLTVLAITFLLGFFLDWVEITLIILPL 368 Query: 361 FVPVAQKLGIDLVWYGVILGANLQTSFLTPPFGFALFYLRGVAPPEVTTSDIYRGVIPFI 420 PV +G+D +W+ ++ LQTSFLTPP GFALFY++GV PP +TT D+Y GV+P+I Sbjct: 369 VAPVLFSMGVDPLWFAILFALCLQTSFLTPPVGFALFYIKGVCPPGITTRDVYLGVLPYI 428 Query: 421 LLQLLVLLLIIIFPGIVSFLPS 442 ++QL+ L L+ F + ++LP+ Sbjct: 429 VIQLIGLALVFYFAPLATWLPN 450 Lambda K H 0.331 0.149 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 569 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 456 Length adjustment: 33 Effective length of query: 412 Effective length of database: 423 Effective search space: 174276 Effective search space used: 174276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory