Align L-rhamnose-1-dehydrogenase ( EC 1.1.1.173) (characterized)
to candidate GFF356 Psest_0357 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= reanno::BFirm:BPHYT_RS28235 (260 letters) >FitnessBrowser__psRCH2:GFF356 Length = 255 Score = 183 bits (465), Expect = 3e-51 Identities = 106/258 (41%), Positives = 149/258 (57%), Gaps = 7/258 (2%) Query: 1 MLLKDKVVIVTGGSRGIGRAIAVACAAEGADVAINYWGDNDVSYGRRSAVAEVVAEIEAL 60 M L+++V +VTG ++GIGR IA+ A EGAD+ IN G D R S + ++ A Sbjct: 1 MRLQNQVALVTGSTQGIGRGIALRLAEEGADIVIN--GRQDDEQARES-----LEQVHAR 53 Query: 61 GRRVIAIEGNVAARETGQQLVRHTVEAFGKVDVLASNAGICPFHAFLDMPPEVLESTVAV 120 GRRV I +V E Q+LVR +E G++D+L +NAG+ AFLD + + + V Sbjct: 54 GRRVCFIAADVGDVEQCQRLVREGIEQMGRLDILVNNAGVQRHAAFLDAQADDYDQVLNV 113 Query: 121 NLNGAFYVTQAAAQQMKLQGTGGAIVATSSISALVGGGMQTHYTPTKAGVHSLMQSCAVA 180 NL G F++ QA A+ ++ G GG I+ SS+ + T Y +K G+ LM++ A+ Sbjct: 114 NLRGPFFLAQAFARYLREHGRGGRIINNSSVHEELPHPNFTAYCASKGGLKMLMRNIAIE 173 Query: 181 LGPYGIRCNSVMPGTIATDLNAQDLADEAKKAYFEKRIPLGRLGRPEDVADCVTFLASDR 240 L P GI N+V PG + T +N + + K A + IP GRLGRP DVA V FLAS Sbjct: 174 LAPLGITVNNVAPGAVETPINRELMNQPEKLASLLQNIPAGRLGRPHDVAGVVAFLASPD 233 Query: 241 ARYVTGAALLVDGGLFVN 258 A Y+TG L+VDGGL N Sbjct: 234 AEYITGTTLVVDGGLLWN 251 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 255 Length adjustment: 24 Effective length of query: 236 Effective length of database: 231 Effective search space: 54516 Effective search space used: 54516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory