Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate GFF2231 Psest_2276 NAD-dependent aldehyde dehydrogenases
Query= metacyc::MONOMER-16244 (495 letters) >FitnessBrowser__psRCH2:GFF2231 Length = 506 Score = 347 bits (890), Expect = e-100 Identities = 199/482 (41%), Positives = 285/482 (59%), Gaps = 17/482 (3%) Query: 22 GLFINNEFVQSKSKKTFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAFHSSWSTSDPQ 81 G +I EFV + F SP E I + + +EDI+ A++AA AA +W + Q Sbjct: 20 GNYIGGEFVPPVKGEYFVNTSPVNGEVIAEFPRSGAEDIEKALDAAHAAA-DAWGKTSVQ 78 Query: 82 VRMKVLYKLADLIDEHADTLAHIEALDNGKSLMCS-KGDVALTAAYFRSCAGWTDKIKGS 140 R +L K+AD I+ + + LA E DNGK++ + DV L A +FR AG +GS Sbjct: 79 DRALILLKIADRIEANLEKLAVAETWDNGKAVRETLNADVPLAADHFRYFAGCIRAQEGS 138 Query: 141 VIETGDTHFNYTRREPIGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAESTPLSAL 200 E + Y EP+GV GQIIPWNFPLLMA+WKL P L G VLK AE TPLS + Sbjct: 139 AAEINEHTAAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALAAGNCIVLKPAEQTPLSIM 198 Query: 201 YLASLIKEAGAPPGVVNVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKAAAESNL 260 ++ + PPGV+N+V GFG AG +++ +I K+AFTGST G HIM+ AAE N+ Sbjct: 199 VFIEVVGDL-LPPGVLNIVQGFGREAGQALATSTRIAKIAFTGSTPVGSHIMRCAAE-NI 256 Query: 261 KKVTLELGGKSPNIVFDD------ADVKSTIQHLVTGIFYNTGEVCCAGSRIYVQEGIYD 314 T+ELGGKSPNI F+D A ++ + LV F+N GEVC SR +QE I++ Sbjct: 257 IPSTVELGGKSPNIFFEDIMNAEPAFIEKAAEGLVLA-FFNQGEVCTCPSRALIQESIFE 315 Query: 315 KIVSEFKNAAESLKIGDPFKEDTFMGAQTSQLQLDKILKYIDIGKKEGATVITGG----- 369 + +++K G+P DT +GAQ S+ Q DKIL Y++I ++EGA ++TGG Sbjct: 316 PFMEVVMKKIKAIKRGNPLDTDTMVGAQASEQQFDKILSYMEIAQQEGAQILTGGAAEKL 375 Query: 370 ERFGNKGYFIKPTIFGDVKEDHQIVRDEIFGPVVTITKFKTVEEVIALANDSEYGLAAGV 429 E + GY+++PT+ + ++ ++EIFGPVV + FK E +A+AND+E+GL AGV Sbjct: 376 EGSLSTGYYVQPTLIKGHNK-MRVFQEEIFGPVVGVATFKDEAEALAIANDTEFGLGAGV 434 Query: 430 HTTNLSTAISVSNKINSGTIWVNTYNDFHPMVPFGGYSQSGIGREMGEEALDNYTQVKAV 489 T +++ A + I +G +W N Y+ + FGGY +SG+GRE + LD+Y Q K + Sbjct: 435 WTRDINRAYRMGRGIKAGRVWTNCYHLYPAHAAFGGYKKSGVGRETHKMMLDHYQQTKNL 494 Query: 490 RI 491 I Sbjct: 495 LI 496 Lambda K H 0.316 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 626 Number of extensions: 25 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 506 Length adjustment: 34 Effective length of query: 461 Effective length of database: 472 Effective search space: 217592 Effective search space used: 217592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory