Align sorbitol dehydrogenase, D-fructose forming (EC 1.1.1.14) (characterized)
to candidate GFF1678 Psest_1716 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= reanno::BFirm:BPHYT_RS16120 (260 letters) >FitnessBrowser__psRCH2:GFF1678 Length = 253 Score = 149 bits (375), Expect = 7e-41 Identities = 93/259 (35%), Positives = 141/259 (54%), Gaps = 13/259 (5%) Query: 1 MAARLQDKVAILTGAASGIGEAVARRYLDEGARCVLVDVKPAD--SFGDSLRATYGDRVL 58 M+ +VA++TGAA+GIG A A+ + ++G + VL D+ A +S+RA G+ + Sbjct: 1 MSMTFSGQVALVTGAAAGIGRATAQAFAEQGLKVVLADIDEAGIRDGAESIRAAGGEAI- 59 Query: 59 TVSADVTRRDDIQRIVASTLERFGQIDILFNNAAL-FDMRPILEESWDVFDRLFAVNVKG 117 V DVTR +++ ++ L +FG++D FNNA + + + E S FD + VNVKG Sbjct: 60 AVRCDVTRDAEVKALIEQVLAQFGRLDYAFNNAGIEIEQGRLAEGSEAEFDAIMGVNVKG 119 Query: 118 MFFLMQAVAQKMVEQGCGGKIINMSSQAGRRGEALVSHYCATKAAVLSYTQSAALALAPH 177 ++ M+ M+ QG GG I+N +S AG +S Y A+K AV+ T+SAA+ A Sbjct: 120 VWLCMKHQLPVMLAQG-GGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYAKK 178 Query: 178 KINVNGIAPGVVDTPMWNEVDALFARYENRPLGEKKRLVGEAVPLGRMGVPDDLTGAALF 237 KI VN + P V+DT M+ YE P K P+GR+G +++ A L+ Sbjct: 179 KIRVNAVCPAVIDTDMFRRA------YEADP--RKAEFAAAMHPVGRIGKVEEIAAAVLY 230 Query: 238 LASADADYITAQTLNVDGG 256 L A + T Q L VDGG Sbjct: 231 LCCDGAAFTTGQALAVDGG 249 Lambda K H 0.321 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 253 Length adjustment: 24 Effective length of query: 236 Effective length of database: 229 Effective search space: 54044 Effective search space used: 54044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory