Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate GFF2105 Psest_2148 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >FitnessBrowser__psRCH2:GFF2105 Length = 285 Score = 103 bits (257), Expect = 4e-27 Identities = 81/270 (30%), Positives = 129/270 (47%), Gaps = 41/270 (15%) Query: 7 LKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSSGNYNF----------- 55 L+ K +TGG SGIG ++ +GA+V ++ + D+HQ + Sbjct: 39 LEGKTAIITGGDSGIGRSVAVLFAREGADVAILYL---DQHQDAEETRTVVEQYGRRCLT 95 Query: 56 WPTDISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKM 115 + D++ K +D + FG++D LVNNA P+ +++ ++E +EK Sbjct: 96 FAGDVADRDVCRKVIDETLAAFGKLDILVNNAAEQHPQEKLED--------ISEEQWEKT 147 Query: 116 VNINQKGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWS 175 N G+F M++AV + K S I+N +S + +GS Y+ATK A+ +FTRS S Sbjct: 148 FRTNIFGMFQMTKAVLPHLGKGAS--IINTTSVTAYKGSPQLLDYSATKGAITAFTRSLS 205 Query: 176 KELGKHGIRVVGVAPGILEKTGLRTPEYEEALAWTRNI--TVEQLREGYSKNSIPLGRSG 233 L + GIRV GVAPG + WT I T + ++ P+ R G Sbjct: 206 MNLAERGIRVNGVAPGPI---------------WTPLISSTFDADEVAEFGSNTPMKRPG 250 Query: 234 RLTEVADFVCYLLSERASYMTGVTTNIAGG 263 + EVA YL S A+Y++G ++ GG Sbjct: 251 QPDEVAPAYVYLASSDAAYVSGQVIHVNGG 280 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 285 Length adjustment: 25 Effective length of query: 242 Effective length of database: 260 Effective search space: 62920 Effective search space used: 62920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory