Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate GFF773 Psest_0787 tripartite ATP-independent periplasmic transporter solute receptor, DctP family
Query= SwissProt::Q9HU18 (331 letters) >FitnessBrowser__psRCH2:GFF773 Length = 332 Score = 377 bits (967), Expect = e-109 Identities = 191/330 (57%), Positives = 243/330 (73%), Gaps = 1/330 (0%) Query: 1 MLKHTAKALVCALSLTVAGIVQA-ADPIVIKFSHVVAEHTPKGQGALLFKKLVEERLPGK 59 M K ALV AL A + A A+PIVIKF+HVVA+ TPKG+GALL K+LVE+R+ GK Sbjct: 1 MYKSCVAALVAALYWFSAPAMAAEAEPIVIKFAHVVADDTPKGKGALLLKQLVEQRMAGK 60 Query: 60 VKVEVYPNSSLFGDGKEMEALLLGDVQIIAPSLAKFEQYTKKLQIFDLPFLFDNIQAVDR 119 VKVEVYPNS+L GD +EM+AL VQ++APS++KF YTKKLQ+FDLPFLFD+ +A+ R Sbjct: 61 VKVEVYPNSTLVGDAEEMQALFDNKVQLLAPSMSKFAPYTKKLQVFDLPFLFDDAEALQR 120 Query: 120 FQQSPQGKELLTSMQDKGITGLGYWHNGMKQLSANKPLREPKDARGLKFRVQASKVLEEQ 179 FQ+ ++LL SM D G+ GL YW+NG+KQLSA PLR+P DA GL FR+Q S VLE Q Sbjct: 121 FQKREAARQLLRSMADHGVYGLAYWNNGLKQLSATTPLRKPSDANGLAFRIQPSPVLEAQ 180 Query: 180 FKAVRANPRKMSFAEVYQGLQTGVVNGTENPWSNIYSQKMHEVQKYITESDHGVLDYMVI 239 F AV A + FA+VY+ L+ GVV G ENPWSNI SQ MH VQ YITES+HGVLDYM+I Sbjct: 181 FAAVGAKSVVLPFAKVYESLKGGVVQGAENPWSNILSQNMHSVQPYITESNHGVLDYMLI 240 Query: 240 TNTKFWNGLPEDVRGVLAKTMDEVTVEVNKQAEALNQGDKQRIVEAKTSEIIELTPEQRA 299 TN FW +P VR L + EVT VN++A A+N+ D++RI+ + +S++I LTPE+R Sbjct: 241 TNNDFWLSMPFAVRSELEGIILEVTQAVNREAAAVNRRDRERILASGSSQLITLTPEERQ 300 Query: 300 EWRKAMQPVWKKFEGEIGADLIKAAEAANQ 329 WR+ M PVWK +E +IGADLI+AA N+ Sbjct: 301 AWREQMLPVWKTYEADIGADLIRAAMTVNR 330 Lambda K H 0.316 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 332 Length adjustment: 28 Effective length of query: 303 Effective length of database: 304 Effective search space: 92112 Effective search space used: 92112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory