Align Alpha-glucosidase; EC 3.2.1.20 (characterized, see rationale)
to candidate GFF3716 Psest_3785 Glycosidases
Query= uniprot:H3K096 (538 letters) >FitnessBrowser__psRCH2:GFF3716 Length = 511 Score = 397 bits (1019), Expect = e-115 Identities = 217/515 (42%), Positives = 293/515 (56%), Gaps = 48/515 (9%) Query: 7 WWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYD 66 WW+G +YQIYPRSF DS GDG+GDLNG+ LD++ L VD +WLSP F SPM D GYD Sbjct: 9 WWKGATVYQIYPRSFADSNGDGIGDLNGVLRHLDHLQQLGVDALWLSPIFRSPMADAGYD 68 Query: 67 VSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKAD 126 +SDY D+DP+FG+L D L+ +AH+ ++V++D V +HTSD+HPWF ESR +R NPK D Sbjct: 69 ISDYCDIDPLFGSLADIDRLIAEAHARNIRVLLDFVPNHTSDEHPWFVESRSSRDNPKRD 128 Query: 127 WFVWADPKPDGTPPNNWLSIFG-GSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQL 185 W++W D PNNW + G GSAWT+D QQYYLH FL QPD+N+ +PE +A Sbjct: 129 WYIWRD------QPNNWRAALGAGSAWTWDEHTQQYYLHLFLAKQPDLNWRNPEVVEAMH 182 Query: 186 DNMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLS 245 D +RFWLD G+DGFR+D ++ D D+P G+ + + N Sbjct: 183 DVLRFWLDRGIDGFRIDVIHCTGKDLSFADDPRCQAGQPLS----DFN-----------D 227 Query: 246 RPENLDFLKDLRALMDEYPG-TTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPH 304 +P + + L+ LR L+D YPG VGE+ + ER+ +Y GD+LH+A+ F+ L+ P Sbjct: 228 QPYSHEVLRGLRKLVDSYPGDRMLVGEV-NIRSTERVLQYYGAGDELHLAFNFNPLDAPW 286 Query: 305 SASYLREVI---ERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSL 361 R I E + + AG AWP W SNHD VR +R+ E + +L +L Sbjct: 287 DPVLFRTCIREVEHWLQPAG-AWPTWVLSNHDNVRQRSRYRGSE---RAARAAAVLLLTL 342 Query: 362 RGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVE 421 RG+ +YQGEELGL +A + E DP GRDGCR P+PW G+ E Sbjct: 343 RGTPFIYQGEELGLEDAHIRDEARIDP---------GGRDGCRAPIPWQAEPPHGWQGAE 393 Query: 422 PWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTR 481 PWLP ELA RQ N+ + LLA R++ PAL GD + ++L + R Sbjct: 394 PWLPFPPDAAELAAERQTGAANSIFALYQRLLAARKASPALHHGDFEELASHPEVLAYRR 453 Query: 482 QKGDETLLCVFNLTGQEQQTTLP------VEVASD 510 Q GD+ L N + EQ P VE+ASD Sbjct: 454 QHGDDCRLVCINFS--EQPHAHPHAGDWHVEIASD 486 Lambda K H 0.320 0.138 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 984 Number of extensions: 76 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 538 Length of database: 511 Length adjustment: 35 Effective length of query: 503 Effective length of database: 476 Effective search space: 239428 Effective search space used: 239428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory