Align Alpha-glucosidase; EC 3.2.1.- (characterized, see rationale)
to candidate GFF3717 Psest_3786 Glycosidases
Query= uniprot:A8LLL3 (552 letters) >FitnessBrowser__psRCH2:GFF3717 Length = 539 Score = 201 bits (511), Expect = 6e-56 Identities = 168/554 (30%), Positives = 251/554 (45%), Gaps = 57/554 (10%) Query: 17 PDWWRGAVIYQIYPRSFQDSNGDGIGDLLGIVERMPYIASLGVDAIWISPFFTSPMKDFG 76 P W+R A IYQI P F+DSNGDG GDL GI ER+ YI LG A+W+ PF+ SP +D G Sbjct: 3 PLWYRNAAIYQIDPTLFRDSNGDGCGDLRGITERLDYIRGLGCTAVWLMPFYQSPFEDAG 62 Query: 77 YDISDYFDVDPMFGSLADFDALIETAHMYGLRVMIDLVLSHTSDQHPWFEESRSSRDNPK 136 YDISD+ VD FG LAD AL+E A GL V+I+LV+ HTS QH WF+E+R R++P Sbjct: 63 YDISDHLQVDERFGDLADIVALLEKAEELGLHVIIELVVQHTSIQHKWFQEARRDRNSPY 122 Query: 137 ADWYVWADAKPDGTPPNNWLSIFGGSGWHWDARRCQYYLHNFLTSQPDLNFHCADVQDAL 196 D+Y+WAD D P S W WD QYY H F +PDL+ V + Sbjct: 123 RDYYIWADEPDDFMEP--IFPTVEDSIWTWDEEAGQYYRHLFYKHEPDLDLTNPRVIHEI 180 Query: 197 LGVGRFWLDRGVDGFRLDTINFYVHDA-------------ELRDNPPLPPEERNSNIAPE 243 + FWL GV GFR+D V A +RD + E + + E Sbjct: 181 ERIMSFWLRLGVSGFRIDAAVHMVRQAGGGELEKGYWLLEHMRDFVTMRRPE--TVLLGE 238 Query: 244 VNPYNHQRHLYSKNQPENLEFLAKFRAMMEEYPAIAAVGEVGDAQYGLEILGQYTRGETG 303 ++ + Y ++ + + L F + ++A A+ + L + Sbjct: 239 IDTDPDKYVEYFGDEADRVTLLLDFWTNNHLFLSLAR----QQAEPLVRALNSQPLPPS- 293 Query: 304 VHMCYAFEFLAQEKLTAKRVAE-VLNKVDEVASDGWACWAFSNHDVMRHVSRWDLTPGAQ 362 H YA ++L+ R+ E N+V + + A+ N + R ++ + G + Sbjct: 294 -HSQYALWIRNHDELSLDRLEEDERNEVMDTFAPDENMRAY-NRGIRRRLA--PMLDGDE 349 Query: 363 RGML---TLLMCLRGSVCLYQGEELGLPEAEVAFDDLQDPYGIEFWPEYKGRDGCRTPMV 419 R + LL L G+ + GEE+G+ DDL P R RTPM Sbjct: 350 RRIAATHALLFSLPGTPIIRYGEEIGMG------DDLDRP----------ERLAVRTPMQ 393 Query: 420 WQSDNMSGGFSIHRPWL--PVSTE----HLGLAVAVQEEAPDALLHHYRRALAFRRAHPA 473 W S+ + GFS + L PV E + + V Q D+L+ + R Sbjct: 394 W-SNEPNAGFSCTKGELAAPVIDEGPFTYEKINVFAQTLRSDSLMARTGNMIRTRIGLRE 452 Query: 474 LVKGDISDVTVVGDVISFLRKDPEETVFVAINMSDAPGAVDLPPGNWM-QIGAELNSGGT 532 + G + V V + +R D TV + +N++D V++ + + + Sbjct: 453 IGIGKRTTVEVNDPAVFAIRHDNGSTVLMLVNLADQETTVEITDDDLQDMVDVLADCDYD 512 Query: 533 SPDG---RVHLGPW 543 P+G ++ LGP+ Sbjct: 513 QPEGTPLKIRLGPY 526 Lambda K H 0.321 0.138 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 905 Number of extensions: 42 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 552 Length of database: 539 Length adjustment: 35 Effective length of query: 517 Effective length of database: 504 Effective search space: 260568 Effective search space used: 260568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory