GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fruII-ABC in Pseudomonas stutzeri RCH2

Align The fructose porter, FruA (fructose-1-P forming IIABC) (Delobbe et al. 1975) FruA is 39% identical to 4.A.2.1.1). fructose can be metabolized to Fru-1-P via this system as well as Fru-6-P by another PTS system (characterized)
to candidate GFF3289 Psest_3353 PTS system, fructose-specific, IIB component/PTS system, fructose subfamily, IIC component

Query= TCDB::P71012
         (635 letters)



>lcl|FitnessBrowser__psRCH2:GFF3289 Psest_3353 PTS system,
           fructose-specific, IIB component/PTS system, fructose
           subfamily, IIC component
          Length = 579

 Score =  434 bits (1116), Expect = e-126
 Identities = 226/527 (42%), Positives = 344/527 (65%), Gaps = 21/527 (3%)

Query: 111 NTHLEALSRLSTLLMREEIRKQLLEAESEDAIID----IINQHDKDDDEEEEEEEAAPAP 166
           N  L  + +   L ++  + K++ ++   +A++D    + +  D   + ++ +E  A   
Sbjct: 55  NADLVVVVKTGPLSLQRFVGKRVAQSTPSEALLDPEAFLRSAADTASELQQADEAEAAHT 114

Query: 167 AGKGKILAVTACPTGIAHTFMAADALKEKAKELGVEIKVETNGSSGIKHKLTAQEIEDAP 226
           +GK K++AVTACPTG+AHTFMAA+AL++ A   G +++VET GS G ++ L A  I  A 
Sbjct: 115 SGKPKLVAVTACPTGVAHTFMAAEALQQAAIRKGYDLQVETRGSVGARNVLEADVIAAAD 174

Query: 227 AIIVAADKQVEMERFKGKRVLQVPVTAGIRRPQELIEKAMNQDAPIYQGSGGGSAASNDD 286
            +++AAD +V++ RF GKRV +      +++P+  +++A+ + A +   SG   A S   
Sbjct: 175 VVLLAADIEVDVARFAGKRVFRCGTGVALKQPEATLDRALEEGAVL---SGNAVATSASG 231

Query: 287 EEAKGKSGSGIGNTFYKHLMSGVSNMLPFVVGGGILVAISFFWGIHSADPNDPSYNTFAA 346
           E+   K+G       YKH+++GVS MLP VV GG+L+A+SF +GI +         T AA
Sbjct: 232 EKKGEKTG------VYKHMLTGVSYMLPMVVAGGLLIALSFVFGIEAFKEE----GTLAA 281

Query: 347 ALNFIGGDNALKLIVAVLAGFIAMSIADRPGFAPGMVGGFMATQANAGFLGGLIAGFLAG 406
           AL  IGG+ A +L+V +LAG+IA SIADRPG APGM+GG +A    AGF+GG+IAGF+AG
Sbjct: 282 ALMKIGGETAFQLMVPLLAGYIAYSIADRPGLAPGMIGGLLAGTLGAGFIGGIIAGFVAG 341

Query: 407 YVVILLKKVFTFIPQSLDGLKPVLIYPLFGIFITGVLMQFVVNTPVAAFMNFLTNWLESL 466
           Y    + +    +P S++ LKP+LI PL    +TG++M ++V TPVA  +  LT +L+++
Sbjct: 342 YAAKAVSRWIP-LPASIESLKPILIIPLLASLVTGLVMIYIVGTPVAKLLAGLTEFLDTM 400

Query: 467 GTGNLVLMGIILGGMMAIDMGGPLNKAAFTFGIAMIDAGNYAPHAAIMAGGMVPPLGIAL 526
           GT N +L+G++LG MM +D+GGP+NKAA+ F + ++ + +YAP AA MA GMVPP+G+ +
Sbjct: 401 GTSNAILLGLLLGTMMCVDLGGPVNKAAYAFSVGLLASQSYAPMAATMAAGMVPPIGMGI 460

Query: 527 ATTIFRNKFTQRDREAGITCYFMGAAFVTEGAIPFAAADPLRVIPAAVVGAAVAGGLTEF 586
           AT I R KF Q +REAG     +G  F++EGAIPFAA DPLRVIPA++ G A+ G L+  
Sbjct: 461 ATLIARRKFAQTEREAGKAALVLGCCFISEGAIPFAAKDPLRVIPASIAGGALTGALSMA 520

Query: 587 FRVTLPAPHGGVFVAFI---TNHPMLYLLSIVIGAVVMAIILGIVKK 630
           F   L APHGG+FV  I    NH +LYL++I+ G++V  +I  ++K+
Sbjct: 521 FGAKLLAPHGGLFVLLIPNAINHALLYLVAILAGSLVTGVIYAVIKQ 567



 Score = 54.7 bits (130), Expect = 1e-11
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 2/132 (1%)

Query: 172 ILAVTACPTGIAHTFMAADALKEKAKELGVEIKVETNGSSGIKHKLTAQEIEDAPAIIVA 231
           +L VTACP G+  + + +  L+  A  LG    VE +    I   LT  +I +A  ++V 
Sbjct: 3   LLIVTACPNGMVTSVLTSRLLEAAAHRLGWSTAVEVHDPKAIGSPLTPAQIANADLVVVV 62

Query: 232 ADKQVEMERFKGKRVLQVPVTAGIRRPQELIEKAMNQDAPIYQGSGGGSAASNDDEE--A 289
               + ++RF GKRV Q   +  +  P+  +  A +  + + Q     +A ++   +  A
Sbjct: 63  KTGPLSLQRFVGKRVAQSTPSEALLDPEAFLRSAADTASELQQADEAEAAHTSGKPKLVA 122

Query: 290 KGKSGSGIGNTF 301
                +G+ +TF
Sbjct: 123 VTACPTGVAHTF 134


Lambda     K      H
   0.320    0.137    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 791
Number of extensions: 36
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 635
Length of database: 579
Length adjustment: 37
Effective length of query: 598
Effective length of database: 542
Effective search space:   324116
Effective search space used:   324116
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory