GapMind for catabolism of small carbon sources

 

Aligments for a candidate for galU in Pseudomonas stutzeri RCH2

Align UTP-glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (characterized)
to candidate GFF2187 Psest_2232 UTP-glucose-1-phosphate uridylyltransferase

Query= BRENDA::O25363
         (273 letters)



>lcl|FitnessBrowser__psRCH2:GFF2187 Psest_2232
           UTP-glucose-1-phosphate uridylyltransferase
          Length = 279

 Score =  371 bits (953), Expect = e-108
 Identities = 178/270 (65%), Positives = 218/270 (80%)

Query: 1   MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR 60
           MIKKCLFPAAGYGTRFLP TK +PKEMLP+V+KPLIQY VEEA+ AG   +AIVTGR KR
Sbjct: 1   MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLNQIAIVTGRGKR 60

Query: 61  SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG 120
           SLED+FD SYE+EHQI+ T+KE  L  IR +I++C FSY RQ +MKGLGHAIL+G  LIG
Sbjct: 61  SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECSFSYTRQVEMKGLGHAILSGRPLIG 120

Query: 121 NEPFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE 180
           +EPFAV+LADDLCI+ D   VL QM  LY +++CSIVAI+EV  EE SKYGVI GE + +
Sbjct: 121 DEPFAVVLADDLCINLDGDPVLAQMVKLYNQFRCSIVAIQEVPPEETSKYGVIAGEMIRD 180

Query: 181 GVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR 240
            +Y +  MVEKP  EDAPSN+A+IGRYILTPDIF+++ +T+PGK  EIQITDAL  QA+ 
Sbjct: 181 DIYRVSHMVEKPKPEDAPSNMAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMRQAQD 240

Query: 241 KRIIAYQFKGKRYDCGSVEGYIEASNAYYK 270
             ++AY+FKG+R+DCGS EGYI A+N  Y+
Sbjct: 241 GCVLAYKFKGQRFDCGSAEGYIAATNFCYE 270


Lambda     K      H
   0.318    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 292
Number of extensions: 5
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 273
Length of database: 279
Length adjustment: 25
Effective length of query: 248
Effective length of database: 254
Effective search space:    62992
Effective search space used:    62992
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

Align candidate GFF2187 Psest_2232 (UTP-glucose-1-phosphate uridylyltransferase)
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01099.hmm
# target sequence database:        /tmp/gapView.32320.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01099  [M=261]
Accession:   TIGR01099
Description: galU: UTP--glucose-1-phosphate uridylyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   3.4e-124  399.6   0.0   3.8e-124  399.4   0.0    1.0  1  lcl|FitnessBrowser__psRCH2:GFF2187  Psest_2232 UTP-glucose-1-phospha


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__psRCH2:GFF2187  Psest_2232 UTP-glucose-1-phosphate uridylyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  399.4   0.0  3.8e-124  3.8e-124       1     261 []       2     264 ..       2     264 .. 0.99

  Alignments for each domain:
  == domain 1  score: 399.4 bits;  conditional E-value: 3.8e-124
                           TIGR01099   1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfDtsyeleakl 75 
                                         i+k+++PaaG+Gtr+LPatka+Pkemlp+v+kPliqy veea++aG+++i++vtgr+kr++edhfD+syele+++
  lcl|FitnessBrowser__psRCH2:GFF2187   2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLNQIAIVTGRGKRSLEDHFDISYELEHQI 76 
                                         89************************************************************************* PP

                           TIGR01099  76 ekknkeellkevrkiaelatilyvrqkeakGLGhavllaeelvgdepfavllgDdlvseeee..alkqlielyek 148
                                         ++++ke++l  +r++++++++ y+rq e+kGLGha+l +++l+gdepfav+l+Ddl+ + +   +l+q+++ly++
  lcl|FitnessBrowser__psRCH2:GFF2187  77 RNTDKEKYLVGIRRLIDECSFSYTRQVEMKGLGHAILSGRPLIGDEPFAVVLADDLCINLDGdpVLAQMVKLYNQ 151
                                         *********************************************************9987666*********** PP

                           TIGR01099 149 tgasiiaveevpkeevskYGvidgeeveeelyevkdlvekPkpeeapsnlaivGrYvltpeifelleetkaGkgg 223
                                         +++si+a++evp ee+skYGvi+ge++ +++y+v+++vekPkpe+apsn+ai+GrY+ltp+if+l+e+t++Gkgg
  lcl|FitnessBrowser__psRCH2:GFF2187 152 FRCSIVAIQEVPPEETSKYGVIAGEMIRDDIYRVSHMVEKPKPEDAPSNMAIIGRYILTPDIFDLIEQTEPGKGG 226
                                         *************************************************************************** PP

                           TIGR01099 224 eiqltDalrlllekeevlavklkgkryDvGdklgylka 261
                                         eiq+tDal  ++++ +vla+k+kg+r+D+G+++gy+ a
  lcl|FitnessBrowser__psRCH2:GFF2187 227 EIQITDALMRQAQDGCVLAYKFKGQRFDCGSAEGYIAA 264
                                         ***********************************976 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (261 nodes)
Target sequences:                          1  (279 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 9.31
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory