Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate GFF857 Psest_0871 ABC-type sugar transport systems, ATPase components
Query= BRENDA::Q97UY8 (353 letters) >FitnessBrowser__psRCH2:GFF857 Length = 371 Score = 194 bits (494), Expect = 2e-54 Identities = 124/369 (33%), Positives = 204/369 (55%), Gaps = 29/369 (7%) Query: 1 MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTG 60 M + ++++ K + + +++++IE+GE +GPSG GK+T +R+IAGL+ ++G Sbjct: 1 MASVTLRDICKSYDGTPITR--HIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSG 58 Query: 61 ELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKR 120 +L D++ V +PP+DR +GMVFQ++ALYP++T EN+AF L + K EI++R Sbjct: 59 DLLIDNQRVND-----LPPKDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRR 113 Query: 121 VEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSAR 180 VE VA+IL + +L P++LSGGQ+QRVA+ R +V++P + L DEP SNLDA +R R Sbjct: 114 VEAVAEILQLDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMR 173 Query: 181 ALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASL 240 + + R+ T++ V+HD + +AD++ VL G++ QVG+P LY P + VA Sbjct: 174 IEIARLHQRIRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGF 233 Query: 241 IG--EINELEGKVTN---EGVVIG-----SLRFPVSVSS----DRAIIGIRPEDVKLSKD 286 +G ++N +E + + E V I L PV S+ D +GIRPE Sbjct: 234 LGSPQMNFVEVRAISASPETVTIELPSGYPLTLPVDGSAVSPGDPLTLGIRPE------H 287 Query: 287 VIKDDSWILVGKGKVKVIGYQG--GLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRK 344 + D G++ V G L +T+ L + + + GE ++ Sbjct: 288 FVMPDEADFTFHGQITVAERLGQYNLLYLTLERLQDVITLCVDGNLRVTEGETFAAGLKA 347 Query: 345 DKIKVFEKN 353 DK +F +N Sbjct: 348 DKCHLFREN 356 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 371 Length adjustment: 29 Effective length of query: 324 Effective length of database: 342 Effective search space: 110808 Effective search space used: 110808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory