Align ABC transporter permease (characterized, see rationale)
to candidate GFF850 Psest_0864 ABC-type sugar transport systems, permease components
Query= uniprot:A0A166QFV1 (320 letters) >FitnessBrowser__psRCH2:GFF850 Length = 521 Score = 107 bits (266), Expect = 8e-28 Identities = 77/266 (28%), Positives = 128/266 (48%), Gaps = 27/266 (10%) Query: 65 GGGTFIGFGNYLFHNGSSWSGILVDPQWWNAVRNTLYFTVVSVGLEVV----LGLLVALL 120 G F GF N+ S +L +P +T GL VV +GL++A L Sbjct: 263 GFTVFTGFANF--------SRVLTEPSIREPFMQIFAWTFAFAGLTVVFTLAVGLVLASL 314 Query: 121 LNIKFT-GRALVRALILIPWAIPTIVSAKIWSWMLNDQFGIINHLMLSLGLIDAPLAWTA 179 L + G+A R ++++P+A+P +S ++ + N FG IN +L GL W + Sbjct: 315 LQWELVRGKAFYRLMLILPYAVPGFISILVFRGLFNQNFGEIN--LLLEGLFGIRPDWFS 372 Query: 180 DADLSMWAVIIVDVWKTVPFVTLLMLAALQMLPSDCYEAARVDGIHPLKVFWRVTLPLLM 239 D L+ ++IV+ W P++ LL + LQ +P D YEA+ +DG PL R+TLP L+ Sbjct: 373 DPSLARTMILIVNTWLGYPYMLLLCMGLLQAIPRDQYEASAIDGASPLDNLLRITLPQLI 432 Query: 240 PALLVAAIFRILDSLRVFDVIYVLTSNSSSTMSMS--------VYARQHLVEFQDVG--- 288 L+ I + F +I +LT + + + + + + FQD G Sbjct: 433 KPLMPLLIACFAFNFNNFVLITLLTRGGPDIIGATTPAGTTDLLVSYTYRIAFQDSGQDF 492 Query: 289 -YGSAASTLLFLVVAVIALLYLYLGR 313 +A +T++F++V +ALL L L + Sbjct: 493 ALAAAIATMIFILVGAMALLNLKLSK 518 Lambda K H 0.329 0.140 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 521 Length adjustment: 31 Effective length of query: 289 Effective length of database: 490 Effective search space: 141610 Effective search space used: 141610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory