Align ABC transporter (characterized, see rationale)
to candidate GFF3591 Psest_3658 spermidine/putrescine ABC transporter ATP-binding subunit
Query= uniprot:A0A166QFW2 (381 letters) >FitnessBrowser__psRCH2:GFF3591 Length = 369 Score = 249 bits (636), Expect = 9e-71 Identities = 136/307 (44%), Positives = 194/307 (63%), Gaps = 8/307 (2%) Query: 14 GGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLIDGRRVNDLEPR 73 G I+RD++L+I GEF+ +GPSG GK+T L ++AG ++ G++L+DGR +N++ P Sbjct: 22 GESLIVRDLNLDIRRGEFLTLLGPSGSGKTTSLMMLAGFETPTAGEILLDGRAINNVPPH 81 Query: 74 ERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQILQLDKLLQRKPKE 133 +R +GMVFQ+YAL+PHM+V +N++F L + K ++ERV + ++QL+ R P + Sbjct: 82 KRDMGMVFQNYALFPHMTVSENLAFPLSVRGMAKPDIKERVKRALAMVQLEGFRNRYPAQ 141 Query: 134 LSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHDRLGSTMIYVTHD 193 LSGGQ+QRVA+ RA+ EP ++L DEPL LD LR QM+ EI LH+RLG T++YVTHD Sbjct: 142 LSGGQQQRVALARALVFEPQLVLMDEPLGALDKQLREQMQMEIKHLHERLGVTVVYVTHD 201 Query: 194 QVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGSPRMNFLSARLQTPGETS 253 Q EA+T++D++ V + G+++Q+ PR LYE+P + FVA FLG N L A L S Sbjct: 202 QGEALTMSDRVAVFHQGQIQQIEDPRTLYEKPVNTFVANFLG--ENNRLPAHLLDRRGDS 259 Query: 254 LVDTLVWGITSLPFDSSNLAAGTPLSLGIRPEHVSLKAADGT-----AGVVVTAVEYLGS 308 L G T + AAGTP+SL IRPE V L A G V + YLG Sbjct: 260 CTVKLGRGETVEALAVNVGAAGTPVSLSIRPERVLLNGASANCPNRFTGRVAEFI-YLGD 318 Query: 309 ETYVHLE 315 + LE Sbjct: 319 HIRIRLE 325 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 369 Length adjustment: 30 Effective length of query: 351 Effective length of database: 339 Effective search space: 118989 Effective search space used: 118989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory