Align aminomethyltransferase; EC 2.1.2.10 (characterized)
to candidate GFF180 Psest_0181 glycine cleavage system T protein
Query= CharProtDB::CH_000563 (364 letters) >FitnessBrowser__psRCH2:GFF180 Length = 360 Score = 425 bits (1092), Expect = e-123 Identities = 215/364 (59%), Positives = 270/364 (74%), Gaps = 6/364 (1%) Query: 1 MAQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGS 60 M Q+TPLY+QH GA+MVDF GW MPLHYGSQ++EHH VR D G+FDVSHMT+VD+ G Sbjct: 1 MGQRTPLYDQHLALGAKMVDFGGWDMPLHYGSQVEEHHQVRRDCGVFDVSHMTVVDVAGE 60 Query: 61 RTREFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREK 120 + +L++LLANDV +L +G+ALY+ MLN GGVIDDLIVY +E +RLVVN++TREK Sbjct: 61 QATAYLQHLLANDVTRLKGTGRALYTAMLNERGGVIDDLIVY-LSEWGYRLVVNASTREK 119 Query: 121 DLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDAQRQAVEGMKPFFGVQAG 180 DL+W+ Q A F +E+ R +L+M+A+QGP+A+ + A L + A+ ++ +KPF G+ G Sbjct: 120 DLAWMQQQAAGFAVEVKERPELAMLAIQGPHARTRTAELVSQARATLIQELKPFQGLAEG 179 Query: 181 DLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEM 240 D FI TGYTGE G EI LP E+A DF LV AG+ P GLGARDTLRLEAG+NLYGQ+M Sbjct: 180 DWFIGRTGYTGEDGLEIILPAEQAPDFLSELVGAGIPPIGLGARDTLRLEAGLNLYGQDM 239 Query: 241 DETISPLAANMGWTIAWEPADRDFIGREALEVQREHG-TEKLVGLVMTEKGVLRNELPVR 299 E +SPLAANMGWT+AWEP +RDF+GR ALE QR G KLVGLV+ E+GVLR VR Sbjct: 240 TEDVSPLAANMGWTVAWEPTERDFVGRAALEQQRAQGDLPKLVGLVLEERGVLRAHQVVR 299 Query: 300 FTDAQGNQHEGIITSGTFSPTLGYSIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRN 359 +G ITSG+FSPTLG SIALARVP G GE A V+IR + PV+V +P FVR+ Sbjct: 300 VNGV----GDGEITSGSFSPTLGKSIALARVPAGTGERAEVEIRGKWYPVRVVQPTFVRH 355 Query: 360 GKAV 363 GK + Sbjct: 356 GKVL 359 Lambda K H 0.320 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 360 Length adjustment: 29 Effective length of query: 335 Effective length of database: 331 Effective search space: 110885 Effective search space used: 110885 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate GFF180 Psest_0181 (glycine cleavage system T protein)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.1971221.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-132 426.8 0.0 3.6e-132 426.6 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF180 Psest_0181 glycine cleavage syst Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF180 Psest_0181 glycine cleavage system T protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 426.6 0.0 3.6e-132 3.6e-132 2 361 .. 3 354 .. 2 355 .. 0.96 Alignments for each domain: == domain 1 score: 426.6 bits; conditional E-value: 3.6e-132 TIGR00528 2 krtpLydlhtelggklvdfaGwelPvqykslieeheavrtkaGlfDvshmgkvelsGskslkfLqrllanDvdaLt 77 +rtpLyd+h lg+k+vdf+Gw +P++y+s++eeh+ vr + G+fDvshm+ v+++G+++ ++Lq+llanDv +L lcl|FitnessBrowser__psRCH2:GFF180 3 QRTPLYDQHLALGAKMVDFGGWDMPLHYGSQVEEHHQVRRDCGVFDVSHMTVVDVAGEQATAYLQHLLANDVTRLK 78 79*************************************************************************9 PP TIGR00528 78 k.GkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeevtldtlskeisllalqGPkak 152 G+a+y+++ln GGv+DDlivy ++ ++lvvna+t+ekDl+w+++++++++ + + + e+++la+qGP+a+ lcl|FitnessBrowser__psRCH2:GFF180 79 GtGRALYTAMLNERGGVIDDLIVYLSEWG--YRLVVNASTREKDLAWMQQQAAGFAVEVKERPELAMLAIQGPHAR 152 77**********************98877..******************************************999 PP TIGR00528 153 tiledlldka....veglkefffvqeaelalkkaliartGytGedGfeiavanekavelwkklveaygvkPiGLga 224 t +l+++a +++lk+f ++ e++ +i rtGytGedG ei+++ e+a ++ +lv a g+ PiGLga lcl|FitnessBrowser__psRCH2:GFF180 153 TRTAELVSQAratlIQELKPFQGLAEGDW-----FIGRTGYTGEDGLEIILPAEQAPDFLSELVGA-GIPPIGLGA 222 88888877763333677999999999998.....********************************.********* PP TIGR00528 225 rDtLrleagmaLyGqeldeeitPleaglgwvvkkerkksdfiGravleeqkengtekklvGlemlekgiarnelkv 300 rDtLrleag++LyGq+++e+++Pl+a++gw+v++e++++df+Gra+le+q+++g klvGl++ e+g++r + v lcl|FitnessBrowser__psRCH2:GFF180 223 RDTLRLEAGLNLYGQDMTEDVSPLAANMGWTVAWEPTERDFVGRAALEQQRAQGDLPKLVGLVLEERGVLRAHQVV 298 ***********************************************************************99999 PP TIGR00528 301 lltngekevGivtsGtlsPtLgknialayvdkelekiGtklevevrnklvkikvvkklfvr 361 + ng G +tsG++sPtLgk+iala+v+ ++ G+++eve+r+k ++++vv++ fvr lcl|FitnessBrowser__psRCH2:GFF180 299 RV-NG-VGDGEITSGSFSPTLGKSIALARVP---AGTGERAEVEIRGKWYPVRVVQPTFVR 354 88.99.899**********************...899**********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (360 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 25.10 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory