Align lactoylglutathione lyase (EC 4.4.1.5) (characterized)
to candidate GFF2617 Psest_2668 Lactoylglutathione lyase and related lyases
Query= BRENDA::Q8ZM36 (144 letters) >FitnessBrowser__psRCH2:GFF2617 Length = 167 Score = 164 bits (414), Expect = 8e-46 Identities = 79/123 (64%), Positives = 95/123 (77%) Query: 19 MIIDRIDHLVLTVSDISTTIRFYEEVLGFSAVTFKQNRKALIFGAQKINLHQQEMEFEPK 78 M I +DHLVLTV+D+ TI FY VLG AVTF + RKAL FG QKINLHQ EFEPK Sbjct: 34 MNISHLDHLVLTVADLEATIDFYTRVLGMQAVTFGEGRKALAFGNQKINLHQAGREFEPK 93 Query: 79 ASRPTPGSADLCFITSTPINDVVSEILQAGISIVEGPVERTGATGEIMSIYIRDPDGNLI 138 A RPTPGSADLCFI +TP+ +V++ + ++IVEGPV+RTGATG I S+Y+RDPD NLI Sbjct: 94 AERPTPGSADLCFIVATPLAEVIAHLQAQQVAIVEGPVQRTGATGPIRSVYLRDPDQNLI 153 Query: 139 EIS 141 E+S Sbjct: 154 ELS 156 Lambda K H 0.321 0.137 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 95 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 144 Length of database: 167 Length adjustment: 17 Effective length of query: 127 Effective length of database: 150 Effective search space: 19050 Effective search space used: 19050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory